Recombinant Human CD73 Protein
Beta LifeScience
SKU/CAT #: BLA-11067P
Recombinant Human CD73 Protein
Beta LifeScience
SKU/CAT #: BLA-11067P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P21589 |
Synonym | 5' NT 5' nucleotidase (CD73) 5' nucleotidase precursor 5' nucleotidase, ecto 5' nucleotidase, ecto (CD73) 5'-NT 5'-nucleotidase 5NTD_HUMAN CD73 CD73 antigen E5NT Ecto 5' nucleotidase Ecto-5'-nucleotidase eN eNT NT NT5 NT5E NTE Purine 5 Prime Nucleotidase |
Description | Recombinant Human CD73 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | WELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEP NVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEG LIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGY TSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMD KLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVP VVQAYAFGKYLGYLKIEFDERGNVISSHGNPILLNSSIPEDPSIKADINK WRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNMGNLICDAMINNNLRHA DETFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGTFDLVQL KGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLC TKCRVPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDIN VVSTYISKMKVIYPAVEGRIKVDHHHHHH |
Molecular Weight | 59 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Hydrolyzes extracellular nucleotides into membrane permeable nucleosides. Exhibits AMP-, NAD-, and NMN-nucleosidase activities. |
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
Protein Families | 5'-nucleotidase family |
Database References | |
Associated Diseases | Calcification of joints and arteries (CALJA) |
Gene Functions References
- Changes in the local expression and activity of CD39 and CD73 in calcified valves suggest their potential role in calcific aortic valve disease. PMID: 30056298
- High expression of NT5E is associated with Prostate Cancer. PMID: 29916747
- Case Report: identify novel mutations in the NT5E gene in patient with calcification of joints and arteries. PMID: 28825389
- High CD73 expression is associated with breast cancer. PMID: 29047106
- High CD73 expression is associated with neoplasms. PMID: 29514610
- NT5E-targeting miRNAs (miR-30b and miR-340) function as tumor suppressors PMID: 29155108
- soluble CD73 might be used as serologic prognostic biomarker in patients with metastatic melanoma patients. PMID: 29202855
- High CD73 expression is associated with the increase in the ability of surviving breast cancer cells to evade innate and adaptive immunity. PMID: 29367423
- analysis of how inhibitors block human CD73 and block efficiently its enzymatic function in the low micromolar range through a non-competitive inhibition mechanism PMID: 29377887
- The Ecto-5'nucleotidase, together with alkaline phosphatase, also expressed apically in oviductal epithelium, complete the hydrolysis sequence by dephosphorylating AMP to adenosine. PMID: 29273916
- this paper shows that simultaneous overexpression of human E5NT and ENTPD1 protects porcine endothelial cells against H2O2-induced oxidative stress and cytotoxicity in vitro PMID: 28389406
- high levels of CD73 are significantly associated with reduced overall survival in patients with head and neck squamous cell carcinoma PMID: 27557512
- Studied role of miR-30a in colorectal cancer(CRC). Found miR-30a is downregulated in CRC, and it inhibits cell proliferation in CRC by reducing expression of CD73. PMID: 28464916
- we demonstrated the existence of CSCs in both cultured ccRCC cell line and tissues, and CD73 as a cell-surface biomarker for ccRCC CSC-like cells. PMID: 28404888
- Induction of ecto-5'-nucleotidase/CD73 by radiation contributes to the radiosensitivity of T24 urinary bladder cancer cell line. PMID: 29305710
- Report prognostic impact of CD73 expression in non-small lung cancers. PMID: 28060732
- Data show that MiR-422a and its target CD73 are involved in early loco(regional) recurrence of head and neck squamous cell carcinoma (HNSCC) tumors and are targets for personalized medicine. PMID: 27281619
- HPV+ cervical cancer cells express higher levels of CD73 than HPV- cells, and this expression is associated with the production of larger amounts of adenosine, as well as a stronger inhibition of proliferation, activation, and cytotoxic activity of CD8+ T cells via interaction with A2A adenosine receptor PMID: 28950987
- High CD73 expression is associated with Melanoma Metastasis. PMID: 28652244
- Hippocampal astrogliosis observed in medial temporal lobe epilepsy patients was accompanied by a proportionate increase in A2A receptor and ecto-5'-nucleotidase/CD73 immunoreactivities. PMID: 27650530
- High CD73 expression is associated with cervical cancer. PMID: 28202050
- Endogenous Plastic Somatic (ePS) cells in a latent state, i.e. lacking SOX2, OCT3/4 and NANOG (SON) expression, in non-diseased breast specimens through immunohistochemical analysis of previously identified ePS-specific biomarkers (CD73(+), EpCAM(+) and CD90(-)). PMID: 27705752
- Down-regulation of CD73 on B cells of patients with viremic HIV correlates with B cell activation and disease progression. PMID: 28193736
- CD73 polymorphisms play a role in calciphylaxis development in dialysis patients. PMID: 28212442
- CD73 expression is upregulated in NSCLC and is correlated with a decrease in miR-30a-5p expression. PMID: 28158983
- This study found that in septic critically ill patients the soluble CD73 levels were generally low and showed a further decrease from 0h to 24h. Moreover, the sCD73 levels were higher in acute kidney injury (AKI) versus non-AKI patients and in non-survivors with severe sepsis than in survivors, but were not independently associated either with the development of AKI or 90-day mortal PMID: 27732656
- concluded that CD39 and CD73 are molecular targets for the development of drugs for ALF patients care PMID: 27899277
- Genetic polymorphism of NT5E may contribute to the pathogenesis of calcific aortic valve disease. PMID: 27906615
- Oxidized low density lipoproteins modulate CD39 and CD73 activity in the endothelium. PMID: 27906627
- CD73 may play an important role in breast cancer stem cells. PMID: 27670764
- This study aimed to investigate the activities of purinergic system ecto-enzymes present on the platelet surface as well as CD39 and CD73 expressions on platelets of sickle cell anemia treated patients. PMID: 27044834
- Aim of the present study was to investigate the role of CD73 in glioma blood vessels; results found that the expression of CD73 in glioma vascular cells is significantly decreased, and this reduction may down-regulate the expression of brain microvascular endothelial tight junction-related proteins PMID: 26884147
- These results provide a finely mapped epitope that can be targeted for selective, potent, and non-competitive inhibition of CD73, as well as establish a strategy for inhibiting enzymes that function in both membrane-bound and soluble states. PMID: 26854859
- CD73 promotes the growth of human colorectal cancer cells through EGFR and the b-catenin/cyclin D1 signaling pathway. CD73 may be used as a valuable biomarker of colorectal cancer. PMID: 26708311
- Our study revealed that CD73 is an independent prognostic factor in prostate cancer. PMID: 26253870
- The NT5E gene is involved in both intrinsic and acquired resistance to platinum-based drugs in ovarian cancer. [meta-analysis] PMID: 26629888
- CD73 expression was significantly correlated with the invasion into adjacent organs. PMID: 26691441
- report on a Chinese family with CALJA and novel compound heterozygous mutations (c.1360G>A (p.Gly454Arg) and c.1387C>T (p.Arg463X)) in NT5E PMID: 26178434
- findings reveal that CD73-generated adenosine promotes epithelial integrity and suggest why loss of CD73 in endometrial cancer allows for tumor progression PMID: 26642367
- CD73 activity from any host cell type is not required for the monocyte/macrophage polarization in the peritoneum towards a pro- or an anti-inflammatory phenotype in vivo PMID: 26258883
- these data suggest a possible role for CD73 and A2A in inflammation observed in patients with T2D and obesity mediated via apoptosis. PMID: 25770019
- This study highlights a role for CD73 as a prognostic marker of patient survival and also as a candidate therapeutic target in high-grade serous ovarian cancers. PMID: 26363007
- role of CD73 and CD39 ectonucleotidases in T cell differentiation PMID: 26226423
- Expression of NPP1 and 5'-nucleotidase by valve interstitial cells promotes the mineralization of the aortic valve through A2aR and a cAMP/PKA/CREB pathway. PMID: 25644539
- Although upregulated CD73 expression in tumor cells correlates with a poor prognosis in patients with rectal adenocarcinoma, the combination of CD73 expression in malignant epithelial cells and tumor stroma may have a better prognostic value PMID: 25677906
- rs9444348 heterozygosity is associated with increased risk of post-traumatic epilepsy development after brain injury. PMID: 26040919
- Species-specific CD73 regulation, with potential significance to cancer, fibrosis, and other diseases characterized by changes in CD73 expression and function. PMID: 25298403
- The Nt5e(-/-) targeted mutant mice recapitulate some, but not all, features of ACDC and serve as a model system to study pharmacologic interventions for ectopic mineralization. PMID: 25486201
- CD73 enhances endothelial barrier function and sprouting in blood but not lymphatic vasculature. PMID: 25402681
- It decompose ATP and produce adenosine, which regulates immunity via adenosine receptor. PMID: 25675814