Recombinant Human CD73 Protein

Name: Recombinant Human CD73 Protein
Brand: Beta LifeScience
SKU: BLA-11067P
Availability: InStock

Collections: Car-nk targets proteins, Cluster of differentiation (cd) proteins, Featured cd protein molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P21589
Synonym	5' NT 5' nucleotidase (CD73) 5' nucleotidase precursor 5' nucleotidase, ecto 5' nucleotidase, ecto (CD73) 5'-NT 5'-nucleotidase 5NTD_HUMAN CD73 CD73 antigen E5NT Ecto 5' nucleotidase Ecto-5'-nucleotidase eN eNT NT NT5 NT5E NTE Purine 5 Prime Nucleotidase
Description	Recombinant Human CD73 Protein was expressed in HEK293. It is a Protein fragment
Source	HEK293
AA Sequence	WELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEP NVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEG LIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGY TSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMD KLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVP VVQAYAFGKYLGYLKIEFDERGNVISSHGNPILLNSSIPEDPSIKADINK WRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNMGNLICDAMINNNLRHA DETFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGTFDLVQL KGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLC TKCRVPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDIN VVSTYISKMKVIYPAVEGRIKVDHHHHHH
Molecular Weight	59 kDa including tags
Purity	Greater than 95% SDS-PAGE
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Hydrolyzes extracellular nucleotides into membrane permeable nucleosides. Exhibits AMP-, NAD-, and NMN-nucleosidase activities.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families	5'-nucleotidase family
Database References	HGNC: 8021 OMIM: 129190 KEGG: hsa:4907 STRING: 9606.ENSP00000257770 UniGene: Hs.153952
Associated Diseases	Calcification of joints and arteries (CALJA)

Gene Functions References

Changes in the local expression and activity of CD39 and CD73 in calcified valves suggest their potential role in calcific aortic valve disease. PMID: 30056298
High expression of NT5E is associated with Prostate Cancer. PMID: 29916747
Case Report: identify novel mutations in the NT5E gene in patient with calcification of joints and arteries. PMID: 28825389
High CD73 expression is associated with breast cancer. PMID: 29047106
High CD73 expression is associated with neoplasms. PMID: 29514610
NT5E-targeting miRNAs (miR-30b and miR-340) function as tumor suppressors PMID: 29155108
soluble CD73 might be used as serologic prognostic biomarker in patients with metastatic melanoma patients. PMID: 29202855
High CD73 expression is associated with the increase in the ability of surviving breast cancer cells to evade innate and adaptive immunity. PMID: 29367423
analysis of how inhibitors block human CD73 and block efficiently its enzymatic function in the low micromolar range through a non-competitive inhibition mechanism PMID: 29377887
The Ecto-5'nucleotidase, together with alkaline phosphatase, also expressed apically in oviductal epithelium, complete the hydrolysis sequence by dephosphorylating AMP to adenosine. PMID: 29273916
this paper shows that simultaneous overexpression of human E5NT and ENTPD1 protects porcine endothelial cells against H2O2-induced oxidative stress and cytotoxicity in vitro PMID: 28389406
high levels of CD73 are significantly associated with reduced overall survival in patients with head and neck squamous cell carcinoma PMID: 27557512
Studied role of miR-30a in colorectal cancer(CRC). Found miR-30a is downregulated in CRC, and it inhibits cell proliferation in CRC by reducing expression of CD73. PMID: 28464916
we demonstrated the existence of CSCs in both cultured ccRCC cell line and tissues, and CD73 as a cell-surface biomarker for ccRCC CSC-like cells. PMID: 28404888
Induction of ecto-5'-nucleotidase/CD73 by radiation contributes to the radiosensitivity of T24 urinary bladder cancer cell line. PMID: 29305710
Report prognostic impact of CD73 expression in non-small lung cancers. PMID: 28060732
Data show that MiR-422a and its target CD73 are involved in early loco(regional) recurrence of head and neck squamous cell carcinoma (HNSCC) tumors and are targets for personalized medicine. PMID: 27281619
HPV+ cervical cancer cells express higher levels of CD73 than HPV- cells, and this expression is associated with the production of larger amounts of adenosine, as well as a stronger inhibition of proliferation, activation, and cytotoxic activity of CD8+ T cells via interaction with A2A adenosine receptor PMID: 28950987
High CD73 expression is associated with Melanoma Metastasis. PMID: 28652244
Hippocampal astrogliosis observed in medial temporal lobe epilepsy patients was accompanied by a proportionate increase in A2A receptor and ecto-5'-nucleotidase/CD73 immunoreactivities. PMID: 27650530
High CD73 expression is associated with cervical cancer. PMID: 28202050
Endogenous Plastic Somatic (ePS) cells in a latent state, i.e. lacking SOX2, OCT3/4 and NANOG (SON) expression, in non-diseased breast specimens through immunohistochemical analysis of previously identified ePS-specific biomarkers (CD73(+), EpCAM(+) and CD90(-)). PMID: 27705752
Down-regulation of CD73 on B cells of patients with viremic HIV correlates with B cell activation and disease progression. PMID: 28193736
CD73 polymorphisms play a role in calciphylaxis development in dialysis patients. PMID: 28212442
CD73 expression is upregulated in NSCLC and is correlated with a decrease in miR-30a-5p expression. PMID: 28158983
This study found that in septic critically ill patients the soluble CD73 levels were generally low and showed a further decrease from 0h to 24h. Moreover, the sCD73 levels were higher in acute kidney injury (AKI) versus non-AKI patients and in non-survivors with severe sepsis than in survivors, but were not independently associated either with the development of AKI or 90-day mortal PMID: 27732656
concluded that CD39 and CD73 are molecular targets for the development of drugs for ALF patients care PMID: 27899277
Genetic polymorphism of NT5E may contribute to the pathogenesis of calcific aortic valve disease. PMID: 27906615
Oxidized low density lipoproteins modulate CD39 and CD73 activity in the endothelium. PMID: 27906627
CD73 may play an important role in breast cancer stem cells. PMID: 27670764
This study aimed to investigate the activities of purinergic system ecto-enzymes present on the platelet surface as well as CD39 and CD73 expressions on platelets of sickle cell anemia treated patients. PMID: 27044834
Aim of the present study was to investigate the role of CD73 in glioma blood vessels; results found that the expression of CD73 in glioma vascular cells is significantly decreased, and this reduction may down-regulate the expression of brain microvascular endothelial tight junction-related proteins PMID: 26884147
These results provide a finely mapped epitope that can be targeted for selective, potent, and non-competitive inhibition of CD73, as well as establish a strategy for inhibiting enzymes that function in both membrane-bound and soluble states. PMID: 26854859
CD73 promotes the growth of human colorectal cancer cells through EGFR and the b-catenin/cyclin D1 signaling pathway. CD73 may be used as a valuable biomarker of colorectal cancer. PMID: 26708311
Our study revealed that CD73 is an independent prognostic factor in prostate cancer. PMID: 26253870
The NT5E gene is involved in both intrinsic and acquired resistance to platinum-based drugs in ovarian cancer. [meta-analysis] PMID: 26629888
CD73 expression was significantly correlated with the invasion into adjacent organs. PMID: 26691441
report on a Chinese family with CALJA and novel compound heterozygous mutations (c.1360G>A (p.Gly454Arg) and c.1387C>T (p.Arg463X)) in NT5E PMID: 26178434
findings reveal that CD73-generated adenosine promotes epithelial integrity and suggest why loss of CD73 in endometrial cancer allows for tumor progression PMID: 26642367
CD73 activity from any host cell type is not required for the monocyte/macrophage polarization in the peritoneum towards a pro- or an anti-inflammatory phenotype in vivo PMID: 26258883
these data suggest a possible role for CD73 and A2A in inflammation observed in patients with T2D and obesity mediated via apoptosis. PMID: 25770019
This study highlights a role for CD73 as a prognostic marker of patient survival and also as a candidate therapeutic target in high-grade serous ovarian cancers. PMID: 26363007
role of CD73 and CD39 ectonucleotidases in T cell differentiation PMID: 26226423
Expression of NPP1 and 5'-nucleotidase by valve interstitial cells promotes the mineralization of the aortic valve through A2aR and a cAMP/PKA/CREB pathway. PMID: 25644539
Although upregulated CD73 expression in tumor cells correlates with a poor prognosis in patients with rectal adenocarcinoma, the combination of CD73 expression in malignant epithelial cells and tumor stroma may have a better prognostic value PMID: 25677906
rs9444348 heterozygosity is associated with increased risk of post-traumatic epilepsy development after brain injury. PMID: 26040919
Species-specific CD73 regulation, with potential significance to cancer, fibrosis, and other diseases characterized by changes in CD73 expression and function. PMID: 25298403
The Nt5e(-/-) targeted mutant mice recapitulate some, but not all, features of ACDC and serve as a model system to study pharmacologic interventions for ectopic mineralization. PMID: 25486201
CD73 enhances endothelial barrier function and sprouting in blood but not lymphatic vasculature. PMID: 25402681
It decompose ATP and produce adenosine, which regulates immunity via adenosine receptor. PMID: 25675814

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.