Recombinant Human MMP2 Protein
Beta LifeScience
SKU/CAT #: BLA-5865P
Recombinant Human MMP2 Protein
Beta LifeScience
SKU/CAT #: BLA-5865P
Collections: Enzymes, Protease, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P08253 |
Synonym | 72 kDa gelatinase 72kD type IV collagenase CLG 4 CLG 4A CLG4 CLG4A Collagenase Type 4 alpha Collagenase type IV A Gelatinase A Gelatinase alpha Gelatinase neutrophil Matrix metallopeptidase 2 gelatinase A 72kDa gelatinase 72kDa type IV collagenase Matrix Metalloproteinase 2 Matrix metalloproteinase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) Matrix metalloproteinase II Matrix metalloproteinase-2 MMP 2 MMP II MMP-2 MMP2 MMP2_HUMAN MONA Neutrophil gelatinase PEX TBE 1 TBE-1 |
Description | Recombinant Human MMP2 Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQK FFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRII GYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHG DGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNAD GEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEAL FTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKY GFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCAT TANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY TKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDG IAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAP QEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKN KKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGG HSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGCHHHHHHHHHH |
Molecular Weight | 72 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific Activity:511 pmole/min/µg.Activation: This is a proform enzyme and requires activation prior to testing activity. Dilute the enzyme to 100 ng/ml in a solution containing 50 mM HEPES, pH 7.4, 10 mM CaCl2, 0.05% Brij-35, and 1 mM APMA (amino-phenyl mercuric acetate). Incubate at 37C for 2 hours.Assay conditions: Reaction mixture with 10 μM 390 MMP substrate 1. Incubate for 30 minutes at room temperature. Fluorescence intensity is measured at exc328/em393. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |