Recombinant Mouse IL2 Receptor alpha Protein
Beta LifeScience
SKU/CAT #: BLA-0499P
Recombinant Mouse IL2 Receptor alpha Protein
Beta LifeScience
SKU/CAT #: BLA-0499P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P01590 |
Synonym | Interleukin 2 receptor alpha chain CD25 CD25 antigen IDDM10 IL 2 receptor alpha subunit IL-2 receptor subunit alpha IL-2-RA IL-2R subunit alpha IL2 RA IL2 Receptor alpha IL2-RA IL2R IL2R, alpha chain IL2RA IL2RA_HUMAN IMD41 Interleukin 2 receptor Interleukin 2 receptor alpha Interleukin-2 receptor subunit alpha p55 t-cell growth factor receptor TAC TAC antigen TCGFR |
Description | Recombinant Mouse IL2 Receptor alpha Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSW SSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHC REPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKT GWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTE TTAMTETFVLTMEYK |
Molecular Weight | 27 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Immobilized biotinylated human IL-2, Fc Tag, Avi Tag at 5 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate, can bind this protein with a linear range of 5-40 ng/mL.Immobilized the recombinant protein at 5 μg/mL (100 μL/well) can bind biotinylated human IL-2, Fc Tag, Avi Tag with a linear range of 0.6-10 ng/mL. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |