Recombinant Anemonia Sulcata Delta-Actitoxin-Avd1C (DELTA-AITX-AVD1C) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03253P

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Anemonia sulcata (Mediterranean snakelocks sea anemone) Delta-actitoxin-Avd1c.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Anemonia sulcata (Mediterranean snakelocks sea anemone) Delta-actitoxin-Avd1c.
Recombinant Anemonia Sulcata Delta-Actitoxin-Avd1C (DELTA-AITX-AVD1C) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03253P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Anemonia Sulcata Delta-Actitoxin-Avd1C (DELTA-AITX-AVD1C) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P01528 |
Target Symbol | P01528 |
Synonyms | Delta-actitoxin-Avd1c; Delta-AITX-Avd1c; ATX-II; ATX II; Anemonia sulcata toxin 2; As2; Neurotoxin 2; Toxin II |
Species | Anemonia sulcata (Mediterranean snakelocks sea anemone) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ |
Expression Range | 1-47aa |
Protein Length | Full Length |
Mol. Weight | 6.9kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. Has a strong effect on crustaceans and insects (DmNav1) and a weaker effect on mammals. This toxin is highly potent at mammalian Nav1.1/SCN1A (EC(50)=6.01 nM) and Nav1.2/SCN2A (EC(50)=7.88 nM). It has also great activity on Nav1.5/SCN5A (EC(50)=49.05 nM), Nav1.4/SCN4A (EC(50)=109.49 nM) and Nav1.6/SCN8A (EC(50)=about 180 nM) and is less potent on Nav1.3/SCN3A (EC(50)=759.22 nM) (when measured as the increase in the slow component). |
Subcellular Location | Secreted. Nematocyst. |
Protein Families | Sea anemone sodium channel inhibitory toxin family, Type I subfamily |