Recombinant Bovine Cation-Independent Mannose-6-Phosphate Receptor (IGF2R)

Name: Recombinant Bovine Cation-Independent Mannose-6-Phosphate Receptor (IGF2R)
Brand: Beta LifeScience
SKU: BLC-06766P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - tag-free proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Bovine Cation-Independent Mannose-6-Phosphate Receptor (IGF2R) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P08169
Target Symbol	IGF2R
Species	Bos taurus (Bovine)
Expression System	Yeast
Tag	Tag-Free
Target Protein Sequence	LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
Expression Range	628-772aa
Protein Length	Partial
Mol. Weight	17.1 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Mediates the transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelysosomal compartment where the low pH mediates the dissociation of the complex. The receptor is then recycled back to the Golgi for another round of trafficking through its binding to the retromer. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation by binding DPP4.
Subcellular Location	Golgi apparatus membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein.
Protein Families	MRL1/IGF2R family
Database References	KEGG: bta:281849 STRING: 9913.ENSBTAP00000037502 UniGene: Bt.4977

Gene Functions References

suggest that the insulin like growth factor 2 receptor(IGF2R) gene polymorphisms could be useful genetic markers for dairy production traits in cattle PMID: 29785901
study hypothesizes that reduced granulosa cell insulin-like growth factor II receptor expression in F2 follicles of Twinner cows may play a role in the development of 2 or more dominant follicles PMID: 24209503
imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy PMID: 23593146
Increases in CYP19A1 and FSHR mRNA expression and decreases in IGF2R mRNA expression in follicles of Twinners support the hypothesis that increased follicular development and steroidogenesis result from increased extra-ovarian IGF-1 production. PMID: 22266997
Sex-sorting procedure by flow cytometry did not affect the overall DNA methylation patterns of the IGF2 and IGF2R genes, although individual variation in their methylation patterns among bulls was observed. PMID: 22128039
Study demonstrates associations between IGF2R polymorphisms and growth- and body-related traits in cattle. PMID: 22221028
Data describes the long-term changes to skeletal muscle growth and IGF1, 2, 1R, and 2R mRNA expression in progeny after exposure to high and low levels of maternal nutrient intake during the first two trimesters of gestation in the bovine. PMID: 21056085
Expression and binding properties of mannose-6-phosphate receptors CD-MPR and CI-MPR differ during perinatal development in rat liver. PMID: 12127995
the interaction between uPAR and Man-6-P/IGF2R is a low percentage binding event and that suPAR and full-length uPAR bind the Man-6-P/IGF2R by different mechanisms. PMID: 12665524
Results describe the crystal structure of the N-terminal 432 residues of the cation-independent mannose 6-phosphate receptor, which encompass three out of the 15 repetitive domains of its extracytoplasmic region. PMID: 15085180
crystal structure of the N-terminal 432 residues reveals the unique architecture of binding pocket and provides insight into recognition of a variety of mannose-containing sugars PMID: 15169779
CI-MPR contains a third Man-6-P recognition site that is located in domain 5 and that exhibits lower affinity than the carbohydrate-binding sites present in domains 1-3 and 9 PMID: 15252023
The methylation at Igf-2r imprinting control region showed significant variation in tissues, such as blood, liver, brain, heart and heart, and suggested that Igf-2r imprinting was tissue-specifically regulated. PMID: 17150312
The role of insulin-like growth factor 2 (IGF2) and the regulation of the IGF2 receptor (IGF2R) during follicular development were studied. PMID: 17360960
Placental expression of IGF-IIR mRNA was greater for Nuclear transfer-derived than in vivo-derived embryos. PMID: 17628655
study to assess the mRNA expression of IGF-I, IGF-II, IGF-IR and IGF-IIR in bovine oocytes and different stages of preimplantation embryos PMID: 19013732
Variable pattern of IGF2R allelic expression in major organs such as the brain, cotyledon, heart, liver, lung, spleen, kidney and intercotyledon was observed using a G/A transition in the 3'UTR of IGF2R PMID: 19217227

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.