Recombinant Bovine Cation-Independent Mannose-6-Phosphate Receptor (IGF2R)
Beta LifeScience
SKU/CAT #: BLC-06916P

Greater than 90% as determined by SDS-PAGE.
Recombinant Bovine Cation-Independent Mannose-6-Phosphate Receptor (IGF2R)
Beta LifeScience
SKU/CAT #: BLC-06916P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Bovine Cation-Independent Mannose-6-Phosphate Receptor (IGF2R) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P08169 |
Target Symbol | IGF2R |
Species | Bos taurus (Bovine) |
Expression System | Mammalian cell |
Tag | Tag-Free |
Target Protein Sequence | LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP |
Expression Range | 628-772aa |
Protein Length | Partial |
Mol. Weight | 18.4 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Mediates the transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelysosomal compartment where the low pH mediates the dissociation of the complex. The receptor is then recycled back to the Golgi for another round of trafficking through its binding to the retromer. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation by binding DPP4. |
Subcellular Location | Golgi apparatus membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. |
Protein Families | MRL1/IGF2R family |
Database References |
Gene Functions References
- suggest that the insulin like growth factor 2 receptor(IGF2R) gene polymorphisms could be useful genetic markers for dairy production traits in cattle PMID: 29785901
- study hypothesizes that reduced granulosa cell insulin-like growth factor II receptor expression in F2 follicles of Twinner cows may play a role in the development of 2 or more dominant follicles PMID: 24209503
- imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy PMID: 23593146
- Increases in CYP19A1 and FSHR mRNA expression and decreases in IGF2R mRNA expression in follicles of Twinners support the hypothesis that increased follicular development and steroidogenesis result from increased extra-ovarian IGF-1 production. PMID: 22266997
- Sex-sorting procedure by flow cytometry did not affect the overall DNA methylation patterns of the IGF2 and IGF2R genes, although individual variation in their methylation patterns among bulls was observed. PMID: 22128039
- Study demonstrates associations between IGF2R polymorphisms and growth- and body-related traits in cattle. PMID: 22221028
- Data describes the long-term changes to skeletal muscle growth and IGF1, 2, 1R, and 2R mRNA expression in progeny after exposure to high and low levels of maternal nutrient intake during the first two trimesters of gestation in the bovine. PMID: 21056085
- Expression and binding properties of mannose-6-phosphate receptors CD-MPR and CI-MPR differ during perinatal development in rat liver. PMID: 12127995
- the interaction between uPAR and Man-6-P/IGF2R is a low percentage binding event and that suPAR and full-length uPAR bind the Man-6-P/IGF2R by different mechanisms. PMID: 12665524
- Results describe the crystal structure of the N-terminal 432 residues of the cation-independent mannose 6-phosphate receptor, which encompass three out of the 15 repetitive domains of its extracytoplasmic region. PMID: 15085180
- crystal structure of the N-terminal 432 residues reveals the unique architecture of binding pocket and provides insight into recognition of a variety of mannose-containing sugars PMID: 15169779
- CI-MPR contains a third Man-6-P recognition site that is located in domain 5 and that exhibits lower affinity than the carbohydrate-binding sites present in domains 1-3 and 9 PMID: 15252023
- The methylation at Igf-2r imprinting control region showed significant variation in tissues, such as blood, liver, brain, heart and heart, and suggested that Igf-2r imprinting was tissue-specifically regulated. PMID: 17150312
- The role of insulin-like growth factor 2 (IGF2) and the regulation of the IGF2 receptor (IGF2R) during follicular development were studied. PMID: 17360960
- Placental expression of IGF-IIR mRNA was greater for Nuclear transfer-derived than in vivo-derived embryos. PMID: 17628655
- study to assess the mRNA expression of IGF-I, IGF-II, IGF-IR and IGF-IIR in bovine oocytes and different stages of preimplantation embryos PMID: 19013732
- Variable pattern of IGF2R allelic expression in major organs such as the brain, cotyledon, heart, liver, lung, spleen, kidney and intercotyledon was observed using a G/A transition in the 3'UTR of IGF2R PMID: 19217227