Recombinant Caenorhabditis Elegans Dauer Larva Development Regulatory Growth Factor Daf-7 (DAF-7) Protein (His&Myc)

Name: Recombinant Caenorhabditis Elegans Dauer Larva Development Regulatory Growth Factor Daf-7 (DAF-7) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-06467P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Caenorhabditis Elegans Dauer Larva Development Regulatory Growth Factor Daf-7 (DAF-7) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P92172
Target Symbol	DAF-7
Species	Caenorhabditis elegans
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	SHAKPVCNAEAQSKGCCLYDLEIEFEKIGWDWIVAPPRYNAYMCRGDCHYNAHHFNLAETGHSKIMRAAHKVSNPEIGYCCHPTEYDYIKLIYVNRDGRVSIANVNGMIAKKCGCS
Expression Range	235-350aa
Protein Length	Full Length of Mature Protein
Mol. Weight	18.1 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Under harsh environmental conditions, larvae enter a developmentally arrested state known as dauer; TGF-beta-like daf-7 acts to inhibit dauer larva formation and promote growth. May be a ligand to cell surface receptor daf-4. May act as a negative regulator of dauer larva development by transducing chemosensory information from ASI neurons. Involved in sensitivity to CO2 levels. In AWC neurons, acts to promote expression of srsx-3, a member of the GPCR family.
Subcellular Location	Secreted.
Protein Families	TGF-beta family
Database References	KEGG: cel:CELE_B0412.2 STRING: 6239.B0412.2 UniGene: Cel.19630
Tissue Specificity	Expression in the chemosensory neurons.

Gene Functions References

DAF-7 expression decreases as animals age during adulthood. Age-dependent diminished expression contributes to the reduced sensitivity of aging animals to the effects of dietary restriction. PMID: 28107363
Using functional, fluorescently-tagged protein, we find that, in animals with mutant DAF-28/IGF, the wild-type DAF-7/TGF-beta is mislocalized to and accumulates in the proximal axon of the ASI neuron. Activation of two different branches of the unfolded protein response can modulate both the developmental phenotype and DAF-7 mislocalization in DAF-28(R37C) animals, but appear to act through divergent mechanisms PMID: 27926939
GLR-1 protein and glr-1 transcription are increased in neurons of DAF-7 mutants. PMID: 26054666
daf-7 has a role in larval development and specifically affects molting and excretory canal development PMID: 23526825
We show that aggregation and bordering are genetically complex, with multiple contributing quantitative trait loci (QTLs), and refine one QTL to identify a new gene affecting the daf-7 pathway, the GABA receptor EXP-1. PMID: 23284308

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.