Recombinant EBV gp340/220 Envelope Protein (Tagged)

Name: Recombinant EBV gp340/220 Envelope Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-11512P
Availability: InStock

Collections: Featured viral antigens molecules, Other viral antigens, Recombinant proteins, Viral antigen

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Accession	P03200
Synonym	BLLF1a Envelope glycoprotein Gp220/340 Envelope glycoprotein GP340/220 Envelope glycoprotein GP340/GP220 Epstein Barr gp350 envelope protein Epstein Barr virus Epstein Barr Virus envelope glycoprotein complex 250/350 gp 350 Gp350 MA Membrane antigen
Description	Recombinant EBV gp340/220 Envelope Protein (Tagged) was expressed in E.coli. It is a Protein fragment
Source	E.coli
AA Sequence	MEAALLVCQYTIQSLIHLTGEDPGFFNVEIPEFPFYPTCNVCTADVNVTI NFDVGGKKHQLDLDFGQLTPHTKAVYQPRGAFGGSENATNLFLLELLGAG ELALTMRSKKLPINVTTGEEQQVSLESVDVYFQDVFGTMWCHHAEMQNPV YLIPETVPYIKWDNCNSTNITAVVRAQGLDVTLPLSLPTSAQDSNFSVKT EMLGNEIDIECIMEDGEISQVLPGDNKFNITCSGYESHVPSGGILTSTSP VATPIPGTGYAYSLRLTPRPVSRFLGNNSILYVFYSGNGPKASGGDYCIQ SNIVFSDEIPASQDMPTNTTDITYVGDNATYSVPMVTSEDANSPNVTVTA FWAWPNNTETDFKCKWTLTSGTPSGCENISGAFASNRTFDITVSGLGTAP KTLIITRTATNATTTTHKVIFSKAPESTTTSPTLNTTGFADPNTTTGLPS STHVPTNLTAPASTGPTVSTADVTSPTPAGTTSGASPVTPSPS
Molecular Weight	69 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Initiates virion attachment to host B-lymphocyte cell, leading to virus entry. Acts by binding to host CR2 at the surface of B-lymphocytes, facilitating the binding of viral glycoprotein gp42 to HLA class II molecules. Attachment triggers virion-host membrane fusion and invasion of the host cell.
Subcellular Location	Virion membrane; Single-pass membrane protein. Host membrane; Single-pass membrane protein. Note=Most abundant component of the viral envelope.
Protein Families	Epstein-Barr GP350 family
Database References	KEGG: vg:3783713

Gene Functions References

The similar distribution of gp350/220 variants in nasopharyngeal carcinoma, EBV-associated gastric carcinoma and healthy donors suggest that gp350/220 variations are geographically restricted rather than tumor-specific polymorphisms. PMID: 22038027
gp350 mainly exerts its functions after the internalization step, presumably during release of the viral capsid from the endosomal compartment, and that CD21-dependent but also CD21-independent molecular mechanisms are involved in this process. PMID: 19889766
X-ray structure of the highly glycosylated gp350; defined the CR2 binding site on gp350, deglycosylated gp350 bound CR2 similarly to the glycosylated form, suggesting that glycosylation is not important for receptor binding PMID: 17072314
These site-directed mutations identified a novel negatively charged complement receptor type 2-binding surface described by residues Glu-21, Asp-22, Glu-155, Asp-208, Glu-210, and Asp-296. PMID: 18786993

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.