Recombinant Feline Immunodeficiency Virus Gag Polyprotein (GAG) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01013P

Greater than 90% as determined by SDS-PAGE.
Recombinant Feline Immunodeficiency Virus Gag Polyprotein (GAG) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01013P
Collections: Featured viral antigens molecules, Hiv, Recombinant proteins, Viral antigen
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Feline Immunodeficiency Virus Gag Polyprotein (GAG) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P16087 |
Target Symbol | GAG |
Species | Feline immunodeficiency virus (isolate Petaluma) (FIV) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | MGNGQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQAY |
Expression Range | 1-135aa |
Protein Length | Partial |
Mol. Weight | 22.1 kDa |
Research Area | Microbiology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Matrix protein p15 forms the outer shell of the core of the virus, lining the inner surface of the viral membrane.; Capsid protein p24 forms the conical core of the virus that encapsulates the genomic RNA-nucleocapsid complex.; Nucleocapsid protein p13 encapsulates and protects viral dimeric unspliced (genomic) RNA. Binds these RNAs through its zinc fingers. |
Subcellular Location | [Matrix protein p15]: Virion.; [Capsid protein p24]: Virion.; [Nucleocapsid protein p13]: Virion. |
Protein Families | Feline lentivirus group gag polyprotein family |