Recombinant gp120(Con_A1)
Beta LifeScience
SKU/CAT #: BLIT-0175
Recombinant gp120(Con_A1)
Beta LifeScience
SKU/CAT #: BLIT-0175
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Tag | His |
Description | Recombinant gp120(Con_A1) was purified from 293 cell culture; .His tagged HIV-1 gp120 (Con_A1/2006) protein (a.a.34-518) ((SEQ: enlwvtvyygvpvwkdaettlfcasdakayetemhnvwathacvptdpnpqeihlenvteefnmwknnmveqm htdiislwdqslkpcvkltplcvtlncsnvnvtnnttntheeeikncsfnmtt |
Source | HEK293 . |
AA Sequence | a.a.34-518 |
Purity | > 95% |
Formulation | Each vial contains 100 µg of purified protein (1 mg/ml) in PBS containing 0.1% BSA and 25% glycerol. |
Applications | WB, etc |
Usage | For Research Use Only |
Storage | The virus antigen is stable for a month at 4°C. It should be stored at -20°C from the date of shipment. Please avoid repeated freeze thaw cycles. |