Recombinant Halobacterium Salinarum Cobalamin Import Atp-Binding Protein Btud (BTUD)
Beta LifeScience
SKU/CAT #: BLC-05268P

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) btuD.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) btuD.
Recombinant Halobacterium Salinarum Cobalamin Import Atp-Binding Protein Btud (BTUD)
Beta LifeScience
SKU/CAT #: BLC-05268P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Halobacterium Salinarum Cobalamin Import Atp-Binding Protein Btud (BTUD) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | B0R5G4 |
Target Symbol | BTUD |
Synonyms | btuD; OE_2955FCobalamin import ATP-binding protein BtuD; EC 7.6.2.8; Vitamin B12-transporting ATPase |
Species | Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) |
Expression System | E.coli |
Tag | Tag-Free |
Target Protein Sequence | MTLDVTGLDVELAGTRILDDVHASIRDGHLVGVVGPNGAGKSTLLRAMNGLITPTAGTVLVAGDDVHALSSAAASRRIATVPQDASVSFEFTVRQVVEMGRHPHTTRFGTDTDTAVVDRAMARTGVAQFAARDVTSLSGGERQRVLLARALAQAAPVLLLDEPTASLDVNHQIRTLEVVRDLADSEDRAVVAAIHDLDLAARYCDELVVVADGRVHDAGAPRSVLTPDTIRAAFDARVAVGTDPATGAVTVTPLPDRTSAAADTSVHVVGGGDSATPVVRRLVSAGASVSVGPVVEGDTDHETARRVGCPCTSVAPFTRLEDTTAASATRADIAAADVIAVPVAAAARPGVRGLLTGAVPTLAVGDAAGAPEWADRLVACDAVVSAVGALADTPSDGV |
Expression Range | 1-398aa |
Protein Length | Full Length |
Mol. Weight | 40.5 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin (vitamin B12) import. Probably responsible for energy coupling to the transport system. |
Subcellular Location | Cell membrane; Peripheral membrane protein. |
Protein Families | ABC transporter superfamily |
Database References | KEGG: hsl:OE_2955F |