Recombinant Helicobacter pylori CagA Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-11521P
Recombinant Helicobacter pylori CagA Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-11521P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Helicobacter pylori |
Accession | P80200 |
Synonym | 120 kDa protein CAG pathogenicity island protein 26 cag26 cagA cai Cytotoxicity-associated immunodominant antigen H. pylori CagA H. pylori cytokine associated gene A Helicobacter pylori cytokine associated gene A |
Description | Recombinant Helicobacter pylori CagA Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | KVNAKIDRLNQIASGLGVVGQAAGFPLKRHDKVDDLSKVGLSRNQELAQK IDNLNQAVSEAKAGFFGNLEQTIDKLKDSTKHNPMNLWVESAKKVPASLS AKLDNYATNSHIRINSNIKNGAINEKATGMLTQKNPEWLKLVNDKIVAHN VGSVPLSEYDKIGFNQKNMKDYSDSFKFSTKLNNAVKDTNSGFTQFLTNA FSTASYYCLARENAEHGIKNVNTKGGFQKS |
Molecular Weight | 41 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | May be necessary for the transcription, folding, export, or function of the cytotoxin. |