Recombinant Hepatitis B virus Protein X (His tag)
Beta LifeScience
SKU/CAT #: BLA-11350P
Recombinant Hepatitis B virus Protein X (His tag)
Beta LifeScience
SKU/CAT #: BLA-11350P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Hepatitis B virus |
Accession | P12936 |
Synonym | HBx Peptide X Protein X pX X |
Description | Recombinant Hepatitis B virus Protein X (His tag) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MRGSHHHHHHGSAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPS PSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVL PKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRH KLVCSPAPCNFFTSA |
Molecular Weight | 18 kDa including tags |
Purity | >90% SDS-PAGE.Purity as determined by densitometric image analysis: >90%.Protein quantified by BCA. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at Room Temperature. Store at -80°C. Avoid freeze / thaw cycle. |