Recombinant Hepatitis C virus Hepatitis C Virus E2 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11389P
Recombinant Hepatitis C virus Hepatitis C Virus E2 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11389P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Hepatitis C virus |
Accession | AF009606 |
Synonym | Core protein E1 protein E2 protein Envelope glycoprotein E2 gp68 gp70 HCV E2 NS1 NS2 protein NS3 protease/helicase NS4A protein NS4B protein NS5A protein NS5B RNA dependent RNA polymerase P7 protein Polyprotein |
Description | Recombinant Hepatitis C virus Hepatitis C Virus E2 Protein (His tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | AETHVTGGSAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNES LNTGWLAGLFYQHKFNSSGCPERLASCRRLTDFAQGWGPISYANGSGLDE RPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGAN DTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNTLLCP TDCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWHYPCTINYTIFKVRMY VGGVEHRLEAACNWTRGERCDLEDRDRSELS |
Molecular Weight | 31 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Preservative: 0.1% Sodium azide |