Recombinant HIV1 Nef Protein
Beta LifeScience
SKU/CAT #: BLA-11311P
Recombinant HIV1 Nef Protein
Beta LifeScience
SKU/CAT #: BLA-11311P
Collections: Featured viral antigens molecules, Hiv, Recombinant proteins, Viral antigen
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Accession | AGL78171 |
Synonym | C terminal core protein F protein Nef Negative factor p27 |
Description | Recombinant HIV1 Nef Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MASMTGGQQMGRGHHHHHHENLYFQGGFGGKWSKSSVIGWPAVRERMRRA EPAADGVGAVSRDLEKHGAITSSNTAANNAACAWLEAQEEEEVGFPVTPQ VPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPD WQNYTPGPGVRYPLTFGWCYKLVPVEPDKVEEANKGENTSLLHPVSLHGM DDPEREVLEWRFDSRLAFHHVARELHPEYFKNC |
Molecular Weight | 26 kDa including tags |
Purity | >90% SDS-PAGE.The final product was refolded using temperature shift inclusion body refolding technology and chromatographically purified. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle. |