Recombinant Human APRIL/TNFSF13 Protein
Beta LifeScience
SKU/CAT #: BLA-0109P
Recombinant Human APRIL/TNFSF13 Protein
Beta LifeScience
SKU/CAT #: BLA-0109P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O75888-1 |
Synonym | A proliferation inducing ligand A proliferation-inducing ligand APRIL CD256 TALL-2 TALL2 TNF related death ligand TNF- and APOL-related leukocyte expressed ligand 2 TNF-related death ligand 1 TNF13_HUMAN TNFSF13 TRDL-1 TRDL1 Tumor necrosis factor (ligand) superfamily, member 13 Tumor necrosis factor ligand superfamily member 13 Tumor necrosis factor like protein ZTNF2 Tumor necrosis factor related death ligand 1 UNQ383/PRO715 ZTNF2 |
Description | Recombinant Human APRIL/TNFSF13 Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYG VRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHP DRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL |
Molecular Weight | 43 kDa including tags |
Purity | >95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Immobilized Human BCMA, Mouse IgG2a Fc Tag, low endotoxin at 5 μg/mL (100 μL/well) can bind BLA-0109P with a linear range of 0.6-10 ng/mL.BLA-0109P at 5 μg/mL (100 μL/well) can bind Biotinylated Human TACI, Fc Tag, Avi Tag with a linear range of 0.01-0.313 μg/mL. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |