Recombinant Human C4b Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-12512P
Recombinant Human C4b Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-12512P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P0C0L5 |
Synonym | Basic complement C4 C2B5 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3 C4b C4B1 C4B2 C4B3 CO4B_HUMAN Complement C4 gamma chain Complement component 4B CPAMD3 |
Description | Recombinant Human C4b Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | EAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEK LTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPAS ATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALE RGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHF TKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLL DSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV |
Molecular Weight | 49 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Non-enzymatic component of the C3 and C5 convertases and thus essential for the propagation of the classical complement pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. C4A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while C4B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens.; Derived from proteolytic degradation of complement C4, C4a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. |
Subcellular Location | Secreted. Cell junction, synapse. Cell projection, axon. Cell projection, dendrite. |
Database References | |
Associated Diseases | Systemic lupus erythematosus (SLE); Complement component 4B deficiency (C4BD) |
Tissue Specificity | Complement component C4 is expressed at highest levels in the liver, at moderate levels in the adrenal cortex, adrenal medulla, thyroid gland, and the kidney, and at lowest levels in the heart, ovary, small intestine, thymus, pancreas and spleen. The extr |