Recombinant Human C4d Protein

Name: Recombinant Human C4d Protein
Brand: Beta LifeScience
SKU: BLA-12514P
Availability: InStock

Collections: Complement components, Cytokines and growth factors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P0C0L4
Synonym	acidic C4 Acidic complement C4 basic C4 basic complement C4 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3 C4 C4, chido form C4, Rodgers form C4-1 C4A C4a anaphylatoxin C4A2 C4A3 C4A4 C4A6 C4AD C4b C4B_2 C4B1 C4B12 C4B2 C4B3 C4B5 C4BD C4d C4d fragment C4F C4S CH Chido form of C4 CO4 CO4A_HUMAN Complement C4 A Complement C4 B Complement C4 gamma chain complement C4-A complement C4-B complement C4-B-like complement C4B1a Complement component 4A complement component 4A (Rodgers blood group) Complement component 4B complement component 4B (Chido blood group) complement component 4B (Chido blood group), copy 2 complement component 4B (Chido blood group)-like Complement component 4F Complement component 4S CPAMD2 CPAMD3 DADB-112B14.11 MGC164979 RG Rodgers form of C4
Description	Recombinant Human C4d Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	MASMTGGQQMGRGHHHHHHGNLYFQGGEFTLEIPGNSDPNMIPDGDFNSY VRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRY LDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTW LTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRS MQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANS FLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDN LYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEG KAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGL NVTLSSTGR
Molecular Weight	44 kDa including tags
Purity	Greater than 90% SDS-PAGE
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -80°C.

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.