Recombinant Human C9 Protein

Name: Recombinant Human C9 Protein
Brand: Beta LifeScience
SKU: BLA-12536P
Availability: InStock

Collections: Complement components, Cytokines and growth factors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P02748
Synonym	ARMD15 C9 C9 deficiency C9 deficiency with dermatomyositis C9D CO9_HUMAN Complement component 9 Complement component 9 deficiency Complement component C9 Complement component C9b
Description	Recombinant Human C9 Protein was expressed in Wheat germ. It is a Full length protein
Source	Wheat germ
AA Sequence	QYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFG QFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNG DNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTP FDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQI EAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASSISLHGKGSFR FSYSKNETYQLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVD DIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKASMKRKG VELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENL IDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQ KLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVIL MDGKCLCACPFKFEGIACEISKQKISEGLPALEFPNEK
Molecular Weight	85 kDa including tags
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C9 is the pore-forming subunit of the MAC.
Subcellular Location	Secreted. Target cell membrane; Multi-pass membrane protein.
Protein Families	Complement C6/C7/C8/C9 family
Database References	HGNC: 1358 OMIM: 120940 KEGG: hsa:735 STRING: 9606.ENSP00000263408 UniGene: Hs.654443
Associated Diseases	Complement component 9 deficiency (C9D); Macular degeneration, age-related, 15 (ARMD15)
Tissue Specificity	Plasma (at protein level).

Gene Functions References

The data supports the assumption that C9 gene expression may stimulate the expression of inflammatory (NLRP3) and angiogenic growth factors (VEGF) in retinal pigment epithelial cells. PMID: 30090015
Serum-expressed apolipoprotein B-100 protein, C9 Complement, and gelsolin can be used for differential diagnosis of Barrertts esophagus and adenocarcinoma of esophagus. PMID: 26404905
Data indicate that complement C9 binds to the ATPase domain of mortalin. PMID: 24719326
Liver biopsy specimens from chronically hepatitis C virus-infected patients exhibited a lower level of C9 mRNA expression than liver biopsy specimens from unrelated disease or healthy control human liver RNA. PMID: 23487461
the haploinsufficiency of C9, a terminal complement complex component, engenders reduced intraocular secretion of VEGF and decreased risk for CNV development. PMID: 22190594
C9 and fucosylated form could serve as a useful marker for SQLC. PMID: 21840429
It was concluded that variations in the complement component 9 gene are unlikely to influence clearance of chronic hepatitis B virus infection and hepatocellular carcinoma occurrence. PMID: 21380615
Mapping the intermedilysin-human CD59 receptor interface reveals a deep correspondence with the binding site on CD59 for complement binding proteins C8alpha and C9. PMID: 21507937
These results suggested that the lack of membrane attack complex because of an Arg95Stop mutation of the complement component 9 gene predisposed patients to pathognomonic glomerulonephritis. PMID: 21057849
provided evidence for the recognition of membrane-bound C9 on complement-lysed ghosts by an antibody specific for the helix-turn-helix fold. PMID: 20153530
Data show that mortalin supports cancer cell resistance to complement-dependent cytotoxicity and suggest consideration of mortalin as a novel target for cancer adjuvant immunotherapy. PMID: 19739077
The human complement C9 gene: structural analysis of the 5' gene region and genetic polymorphism studies. PMID: 11881818
C9 binding is dependent on the N-terminal modules (thrombospondin type 1 and low-density lipoprotein receptor class A) of C8 alpha together with the C8 alpha membrane attack complex/perforin domain. PMID: 12463754
Founder effect was demonstrated for the R95X mutation of the C9 gene in Japanese PMID: 12596049
results indicate that the principal binding site for C9 lies within the MACPF domain of C8alpha PMID: 16618117
analysis of the CD59-C9 binding interaction PMID: 16844690

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.