Recombinant Human CD200R Protein
Beta LifeScience
SKU/CAT #: BLA-10910P
Recombinant Human CD200R Protein
Beta LifeScience
SKU/CAT #: BLA-10910P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8TD46 |
Synonym | CD 200R CD200 cell surface glycoprotein receptor CD200 receptor 1 Cd200r1 Cell surface glycoprotein CD200 receptor 1 Cell surface glycoprotein OX2 receptor Cell surface glycoprotein OX2 receptor 1 cell surface glycoprotein receptor CD200 CRTR 2 CRTR2 HCRTR2 MO2R1_HUMAN MOX2 receptor MOX2R OX2R |
Description | Recombinant Human CD200R Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | AAQPNNSLMLQTSKENHALASSSLCMDEKQITQNYSKVLAEVNTSWPVKM ATNAVLCCPPIALRNLIIITWEIILRGQPSCTKAYKKETNETKETNCTDE RITWVSRPDQNSDLQIRTVAITHDGYYRCIMVTPDGNFHRGYHLQVLVTP EVTLFQNRNRTAVCKAVAGKPAAHISWIPEGDCATKQEYWSNGTV TVKSTCHWEVHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLVDHHH HHH |
Molecular Weight | 25 kDa including tags |
Purity | >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. After reconstitution store at -20°C. Avoid freeze / thaw cycle. |