Recombinant Human CD42c/GP1BB Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-11007P
Recombinant Human CD42c/GP1BB Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-11007P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P13224 |
Synonym | Antigen CD42b beta BDPLT1 BS CD_antigen=CD42c Flags: Precursor Glycoprotein Ib (platelet) beta polypeptide Glycoprotein Ib beta polypeptide GP Ib beta GP Ib beta subunit GP1BB GP1bbeta GPIb beta Nuclear localization signal deleted in velocardiofacial syndrome Platelet glycoprotein Ib beta chain Platelet glycoprotein Ib beta polypeptide |
Description | Recombinant Human CD42c/GP1BB Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLL DALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALR GRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRL RRLRARARARAAARLSLTDPLVAERAGTDES |
Molecular Weight | 39 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |