Recombinant Human CD55 Protein
Beta LifeScience
SKU/CAT #: BLA-11027P
Recombinant Human CD55 Protein
Beta LifeScience
SKU/CAT #: BLA-11027P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | CD 55 CD55 CD55 antigen CD55 Cromer blood group system CD55 molecule CD55 molecule (Cromer blood group) CD55 molecule, decay accelerating factor for complement (Cromer blood group) Cd55a Complement decay accelerating factor Complement decay-accelerating factor Complement decay-accelerating factor, GPI-anchored CR CROM Cromer Blood Group antigen Cromer blood group system DAF Daf-GPI DAF_HUMAN Daf1 Dcay accelerating factor for complement (CD55, Cromer blood group system) Decay accelarating factor 1, isoform CRA_a Decay accelerating factor (GPI-form) Decay Accelerating Factor for Complement Decay accelerating factor GPI-form Decay accelerating factor soluble-form GPI-DAF TC |
Description | Recombinant Human CD55 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | LPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQW SDIEEFCNR |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycle. |