Recombinant Human CD5L/CT-2 Protein
Beta LifeScience
SKU/CAT #: BLA-11038P
Recombinant Human CD5L/CT-2 Protein
Beta LifeScience
SKU/CAT #: BLA-11038P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O43866 |
Synonym | AAC-11 AIM API6 APOPTOSIS INHIBITOR 6 APOPTOSIS INHIBITOR OF MACROPHAGES CD5 antigen like (scavenger receptor cysteine rich family) CD5 antigen-like Cd5l CD5L_HUMAN CT 2 CT-2 Highly similar to ANTIGEN WC1.1 [Bos taurus] IgM associated peptide IgM-associated peptide Pdp PRO229 SCAVENGER RECEPTOR CYSTEINE-RICH FAMILY SP ALPHA SP-alpha Spalpha |
Description | Recombinant Human CD5L/CT-2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MKHHHHHHASPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAV LCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEE VYDCSHDEDAGASCENPESSFSPVPEGVRLADGPGHCKGRVEVKHQNQWY TVCQTGWSLRAAKVVCRQLGCGRAVLTQKRCNKHAYGRKPIWLSQMSCSG REATLQDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVL HKGVWGSVCDDNWGEKEDQVVCKQLGCGKSLSPSFRDRKCYGPGVGRIWL DNVRCSGEEQSLEQCQHRFWGFHDCTHQEDVAVICSG |
Molecular Weight | 37 kDa including tags |
Purity | >95% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. |