Recombinant Human CD75 Protein
Beta LifeScience
SKU/CAT #: BLA-11071P
Recombinant Human CD75 Protein
Beta LifeScience
SKU/CAT #: BLA-11071P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P15907 |
Synonym | 6 sialyltransferase 6-sialyltransferase 1 6-ST 1 Alpha 2 Alpha 2,6 ST Alpha 2,6 ST 1 B cell antigen CD75 B-cell antigen CD75 Beta galactoside alpha 2,6 sialyltransferase 1 Beta-galactoside alpha-2 CMP N acetylneuraminate beta galactosamide alpha 2,6 sialyltransferase 1 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2 MGC48859 Sialyltransferase 1 Sialyltransferase 1 (beta galactoside alpha 2,6 sialyltransferase) SIAT1 SIAT1_HUMAN ST6 beta galactosamide alpha 2,6 sialyltranferase 1 ST6Gal I ST6GAL1 ST6GalI ST6N |
Description | Recombinant Human CD75 Protein was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | KEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQ TLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSY KGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRT KAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTK TTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYN FFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGML GIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEK NLVKHLNQGTDEDIYLLGKATLPGFRTIHCVDHHHHHH |
Molecular Weight | 45 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycle. |