Recombinant Human CXCR4 Protein
Beta LifeScience
SKU/CAT #: BLA-13151P
Recombinant Human CXCR4 Protein
Beta LifeScience
SKU/CAT #: BLA-13151P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | C-X-C chemokine receptor type 4 CD184 CD184 antigen Chemokine (C X C motif) receptor 4 Chemokine CXC Motif Receptor 4 CXC-R4 CXCR-4 CXCR4 CXCR4_HUMAN D2S201E FB22 Fusin HM89 HSY3RR LAP 3 LAP3 LCR1 LESTR Leukocyte derived seven transmembrane domain receptor Leukocyte-derived seven transmembrane domain receptor Lipopolysaccharide associated protein 3 Neuropeptide Y receptor Y3 NPY3R NPYR NPYRL NPYY3 NPYY3R Probable G protein coupled receptor lcr1 homolog SDF 1 receptor SDF-1 receptor SEVEN-TRANSMEMBRANE-SEGMENT RECEPTOR Stromal cell derived factor 1 receptor Stromal cell-derived factor 1 receptor WHIM WHIMS |
Description | Recombinant Human CXCR4 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |