Recombinant Human Factor D/CFD Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-3439P
Recombinant Human Factor D/CFD Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-3439P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P00746 |
Synonym | Adipsin Adipsin/complement factor D Adn C3 convertase activator CFAD_HUMAN CFD Complement factor D complement factor D preproprotein D component of complement DF FactorD PFD Properdin factor D |
Description | Recombinant Human Factor D/CFD Protein (denatured) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMILGGREAEAHARPYMASVQLNGAHLCGGV LVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHP DSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWG IVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSC KGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA |
Molecular Weight | 27 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |