Recombinant Human GITR Protein
Beta LifeScience
SKU/CAT #: BLA-10677P
Recombinant Human GITR Protein
Beta LifeScience
SKU/CAT #: BLA-10677P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9Y5U5 |
Synonym | Activation inducible TNFR family receptor Activation-inducible TNFR family receptor AITR CD357 GITR GITR D GITR-D GITRD Glucocorticoid induced TNFR related protein glucocorticoid-induced tnf receptor ligand glucocorticoid-induced tnf receptors ligand Glucocorticoid-induced TNFR-related protein TNF receptor superfamily activation inducible protein TNFRSF 18 TNFRSF18 TNR18_HUMAN Tumor necrosis factor receptor superfamily member 18 Tumor necrosis factor receptor superfamily member 18 precursor |
Description | Recombinant Human GITR Protein was expressed in Insect cells. It is a Protein fragment |
Source | Insect cells |
AA Sequence | QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCV QPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHE GHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLEHHHHHH |
Molecular Weight | 16 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Receptor for TNFSF18. Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway. |
Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted. |
Database References | |
Tissue Specificity | Expressed in lymph node, peripheral blood leukocytes and weakly in spleen. |
Gene Functions References
- HTLV-1 infection can modify the expression of main functional transcription factors, FOXP3 and GITR PMID: 28101786
- a novel molecular mechanism by which MBD4 inhibits GITR expression in a DNMT1-dependent manner PMID: 28542810
- Aberrant expression of GITR may contribute to systemic lupus erithematosus pathogenesis. Glucocorticoid may achieve its therapeutic effect partly by inducing GITR expression on Tresps rather than Tregs, which initiates the apoptosis of Tresp cells in SLE patients. PMID: 25293713
- GITR expression can enhance the sensitivity to Bortezomib by inhibiting Bortezomib-induced NF-kappaB activation. PMID: 25973846
- GITR is a crucial player in differentiation of thymic regulatory T cells and expansion of regulatory T cells, including both thymic regulatory T cells and peripheral regulatory T cells. PMID: 25961057
- Data may suggest a key role of regulatory GITR+CD25 low/-CD4+ T cells subset in the modulation of the abnormal immune response in lupus erythematosus (SLE) patients. PMID: 25256257
- results suggest that the GITR rs3753348 polymorphism may be involved in the development and susceptibility of CWP. PMID: 25445616
- these results show a higher susceptibility to apoptosis in patients' versus controls' T(reg) cells, suggesting that GITR is a T(reg)-cell marker that would be primarily involved in T(reg)-cell survival rather than in their suppressor function. PMID: 23929911
- Our findings indicate the possible involvement of GITR-GITRL pathway in the pathogenesis of pSS. PMID: 23935647
- GITR acts as a potential tumor suppressor in MM. PMID: 23785514
- Data indicate that the mRNAs of CTLA-4 and GITR genes were expressed at lower levels in CVID patients compared to control group. PMID: 23432692
- GITR is pathologically expressed on Treg cells in systemic lupus erythematosus. PMID: 22516990
- Liver tumor Tregs up-regulate the expression of glucocorticoid-induced tumor necrosis factor receptor compared with Tregs in tumor-free liver tissue and blood. PMID: 22911397
- Results suggest that GITR expression might indicate a molecular link between steroid use and complicated acute sigmoid diverticulitis. Increased MMP-9 expression by GITR signalling might explain morphological changes in the colonic wall in diverticulitis. PMID: 22309286
- The regulatory SNPs identified in this study will provide useful information for understanding the relevance of sequence polymorphisms in populations of different background and may serve as a basis to study parasite susceptibility in association studies PMID: 21445534
- GITRL may contribute to disease pathophysiology and resistance to direct and Rituximab-induced NK reactivity in CLL PMID: 22064350
- GITR, which transmits a signal that abrogates regulatory T cell functions, was elevated in early rheumatoid arthritis. PMID: 21670968
- DCs transfected with mRNA encoding a humanized anti-CTLA-4 mAb and mRNA encoding a soluble human GITR fusion protein enhance the induction of anti-tumor CTLs in response to DCs. PMID: 22028176
- Findings suggest that GITR-expression of TILs is associated with cancer progression. PMID: 21694467
- Although GITR transgene costimulation can therapeutically enhance T helper (Th) type 2 cell responses, GITR-GITR ligand interactions are not required for development of Th2-mediated resistance or pathology. PMID: 21705620
- Data indicate that CD4(+) CD25(low) GITR(+) cells represent a low percentage of the CD4(+) T-cell population (0.32-1.74%) and are mostly memory cells. PMID: 21557210
- study concludes, the rs3753348 C/G SNP in the GITR is associated with Hashimoto's disease prognosis and expression on T(reg) and T(eff) cells PMID: 21592113
- GITR rapidly recruits TNF receptor-associated factor 2 (TRAF2) in a ligand-dependent manner; data indicate that the cytoplasmic domain of GITR contains a single TRAF binding site where acidic residues 202/203 and 211-213 are critical for this interaction. PMID: 15944293
- Since regulatory T-cells are localized in the vicinity of GITRL-expressing cells in atopic dermatitis skin, the GITR/GITRL interaction may serve to perpetuate the inflammation locally. PMID: 16955181
- This protein has been shown to stimulate T cell-mediated antitumor immunity in mice, and now in a human tumor cell line. PMID: 17360848
- These data suggest that, despite abnormal GITR expression during HIV infection, GITR triggering enhances HIV-specific CD4(+) T cell cytokine expression and protects HIV-specific CD4(+) T cells from apoptosis. PMID: 17538882
- although GITR is an activation marker for NK cells similar to that for T cells, GITR serves as a negative regulator for NK cell activation PMID: 18230609
- CD4(+)CD25(+) effector memory T-cells expressing CD134 and GITR seem to play a role in disease mechanisms, as suggested by their close association with disease activity and their participation in the inflammatory process in Wegener's granulomatosis. PMID: 18723571
- mechanism of IgG4 induction by regulatory cells involves GITR-GITR-L interactions, IL-10 and TGF-beta. PMID: 18924213
- Data show that in humans GITRL expression subverts NK cell immunosurveillance of AML. PMID: 19155305
- mRNA level for CTLA-4, ICOS1, IL-23, IL-27, SMAD3 and GITR were lower in T regulatory cells of children with diabetes compared to the control patients PMID: 19547759