Recombinant Human Hepatitis C Virus (mutated D168 V) Protein
Beta LifeScience
SKU/CAT #: BLA-11335P
Recombinant Human Hepatitis C Virus (mutated D168 V) Protein
Beta LifeScience
SKU/CAT #: BLA-11335P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | NC_004102 |
Synonym | Genome polyprotein HCV Hepatitis C virus polyprotein |
Description | Recombinant Human Hepatitis C Virus (mutated D168 V) Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MDYKDDDDKHHHHHHGCVVIVGRIVLSGSGSITAYAQQTRGLLGCIITSL TGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPV IQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGD SRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVVFIP VENLETTMRS |
Molecular Weight | 22 kDa including tags |
Purity | >= 53% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |