Recombinant Human HERVK18.2 Protein
Beta LifeScience
SKU/CAT #: BLA-11534P
Recombinant Human HERVK18.2 Protein
Beta LifeScience
SKU/CAT #: BLA-11534P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O42043 |
Synonym | Envelope polyprotein HERV-K(C1a) envelope protein HERV-K_1q23.3 provirus ancestral Env polyprotein HERV-K110 envelope protein HERV-K18 envelope protein HERV-K18 superantigen IDDMK1,2 22 envelope protein IDDMK1,2 22 superantigen |
Description | Recombinant Human HERVK18.2 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | PQGMLNSPTICQTFVAQVLQPVRDKFSDCYIIHYVDDILCAAETRDKLID CYTFLQTEVANAGLTIASDKIQTSTPFHYLGMQVEERKIKPQKVEIRKDT LRTLNDFKNC |
Molecular Weight | 38 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |