Recombinant Human Hla Class Ii Histocompatibility Antigen, Dp Alpha 1 Chain (HLA-DPA1) Protein (His)

Name: Recombinant Human Hla Class Ii Histocompatibility Antigen, Dp Alpha 1 Chain (HLA-DPA1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03549P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Hla Class Ii Histocompatibility Antigen, Dp Alpha 1 Chain (HLA-DPA1) Protein (His) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P20036
Target Symbol	HLA-DPA1
Synonyms	HLA-DPA1; HLA-DP1A; HLASBHLA class II histocompatibility antigen; DP alpha 1 chain; DP(W3); DP(W4); HLA-SB alpha chain; MHC class II DP3-alpha; MHC class II DPA1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTE
Expression Range	29-222aa
Protein Length	Extracellular Domain
Mol. Weight	26.3kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus, trans-Golgi network membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Note=The MHC class II complex transits through a number of intracellular compartments in the endocytic pathway until it reaches the cell membrane for antigen presentation.
Protein Families	MHC class II family
Database References	HGNC: 4938 OMIM: 142880 KEGG: hsa:3113 STRING: 9606.ENSP00000393566 UniGene: Hs.347270

Gene Functions References

HLA-DPA1 and HLA-DPB1 variants can determine susceptibility or protective effect against Hepatitis B virus infection in an Indonesian population. PMID: 27051043
The HLA-B*42, HLA-C*17, HLA-DPA1*03, and HLA-DPB1*105 genotypes were associated with allergic asthma and the HLA-B*48 genotype with the nonallergic phenotype. The presence of the haplotype HLA-DPA1*03 DQA*05 was associated with allergic asthma, and the presence of HLA-DPA1*03 and the absence of HLA-DQA*05 with nonallergic asthma. PMID: 28380482
Single-nucleotide polymorphism in HLA-DPA1 gene is associated with sclerotic graft-versus-host disease. PMID: 27313329
Single-nucleotide polymorphism in HLA-DP is associated with cervical cancer susceptibility. PMID: 26711785
rs3077 in HLA-DPA1 is a significantly associated SNP associated with chronic hepatitis B virus infection and viral clearance. PMID: 24846544
This resource provides population estimates of the frequencies of HLA alleles at these eight loci in the three population groups, particularly for HLA-DPA1 and HLA-DPB1 that were not assayed in HapMap. PMID: 24698974
DPA1*02:01- DPB1*14:01 and DPA1*02:01- DPB1*17:01 haplotypes provide considerable protection effect against Posner-Schlossman syndrome. PMID: 25863099
HLA-DP gene polymorphisms are strongly associated with chronic hepatitis B virus infection. PMID: 25449085
The study suggests that HLA-DPA1/B1 loci are candidate susceptibility regions that have some marker single nucleotide polymorphisms for both chronic hepatitis C virus infection and F protein generation in the Han Chinese population. PMID: 24897020
Single nucleotide polymorphisms rs3077 and rs9277378 in HLA-DPA1 and HLA-DPB1 are significantly associated with protective effects against chronic hepatitis B. PMID: 24465836
It related to persistence of hepatitis B virus (HBV) infection and viral load in chronic HBV. PMID: 23980639
HLA-DPA1 and DPB1 allele frequencies and haplotypes of the population of Guadeloupe were most similar to African populations, with characteristic alleles and haplotypes that bespeaks the admixture with other ethnicities. PMID: 24405442
Crystal structure of the extracellular region of the HLA-DPA1/DPB1 heterodimer, in complex with the major antigenic peptide from the Japanese cedar pollen allergen. PMID: 25020231
Data indicate that CD4+ T cell allorecognition of HLA-DP is significantly affected by DPA1 polymorphism. PMID: 24462895
Studied three HLA-DP and IL28B SNPs of CHB patients with and without spontaneous HBsAg seroclearance.Haplotype analysis of HLA-DP polymorphisms showed association with HBsAg seroclearance. PMID: 23449268
HLA-DP SNPs rs3077, rs9277378 and rs3128917 were associated with chronicity of HBV disease in the Chinese PMID: 23825586
HLA-DP polymorphisms affect affect genotype B hepatitis B virus clearance, regulate immune selection of viral mutations, and influence cirrhosis and hepatocellular carcinoma risks contributed by hepatitis B virus mutations PMID: 24006435
This is the first study that confirms the association of HLA markers and haplotypes around HLA-DPA1 and HLA-DPB1 with ankylosing spondylitis. PMID: 23459078
Data indicate that comparing to GG haplotype of rs3077 (near HLA-DPA1 region) and rs9277535 (near HLA-DPB1 region), GA haplotype had a higher chance of achieving spontaneous HBsAg loss. PMID: 23326374
Significant associations of HLA-DP rs3077 and rs9277535 with increased risks of cervical cancer in a Chinese population were found. PMID: 23428460
HLA-DPA1 genetic variation, proxies for early life immune modulation and childhood acute lymphoblastic leukemia. PMID: 22923493
HLA-DP has a role in protection against chronic hepatitis B and viral clearance in Japanese and Koreans PMID: 22737229
HLA-DPA1 variant is associated with hepatitis B virus infection. PMID: 22448225
A novel variant in the HLA-DPB1 3'UTR region, 496A/G, is associated significantly with HBV recovery in European and African-American populations. PMID: 22496224
Genetic variants of the HLA-DP genes are risk factors for the development of hepatocellular carcinoma in chinese patients. PMID: 22105689
variants previously associated with chronic hepatitis B are also strongly associated with mRNA expression of HLA-DPA1 and HLA-DPB1, suggesting that expression of these genes is important in control of HBV. PMID: 21346778
genetic variants in the HLA-DPA1 and HLA-DPB1 locus are associated with the risk of pediatric asthma in Asian populations. PMID: 21814517
HLA - DPA1 rs3077 T was strongly associated with decreased risk of chronic hepatitis B virus infection (odds ratio, .62; P = .001), consistent with the previous report. PMID: 21402545
Genetic variants in the HLA-DP locus are strongly associated with persistent chronic hepatitis B virus infection in the Han Chinese population. PMID: 21274863
DPA1*020107 was identified from a woman of Ugandan origin by a taxonomy-based sequence analysis of human leukocyte antigen DPA1. It is identical to DPA1*020101 with the exception of a single nucleotide synonymous substitution at codon 58 (GGC-->GGT). PMID: 20470845
HLA-DPA1 allelic and haplotypic diversity contributes significantly to the risk for type 1 diabetes PMID: 20424227
HLA-DPA1 promoter haplotypes are differently distributed in southern Chinese ethnic groups PMID: 15713216
Our findings show that genetic variants in the HLA-DPA1 locus are strongly associated with risk of persistent infection with hepatitis B virus. PMID: 19349983

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.