Recombinant Human IKK gamma/NEMO Protein
Beta LifeScience
SKU/CAT #: BLA-4848P
Recombinant Human IKK gamma/NEMO Protein
Beta LifeScience
SKU/CAT #: BLA-4848P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9Y6K9-1 |
Synonym | IkB kinase associated protein 1 IkB kinase subunit gamma Inhibitor of nuclear factor kappa B kinase subunit gamma AMCBX1 FIP 3 FIP-3 FIP3 Fip3p I kappa B kinase gamma I-kappa-B kinase subunit gamma IkB kinase gamma subunit IkB kinase subunit gamma IkB kinase-associated protein 1 Ikbkg IKK gamma IKK-gamma IKKAP1 IKKG IMD33 Incontinentia pigmenti Inhibitor of kappa light polypeptide gene enhancer in B cells, kinase gamma Inhibitor of kappa light polypeptide gene enhancer in B cells, kinase of, gamma Inhibitor of nuclear factor kappa-B kinase subunit gamma IP IP1 IP2 IPD2 NEMO NEMO_HUMAN NF kappa B essential modifier NF kappa B essential modulator NF-kappa-B essential modifier NF-kappa-B essential modulator ZC2HC9 |
Description | Recombinant Human IKK gamma/NEMO Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPET LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEA RKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLL GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQ VDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSS VVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETV PVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCP KCQYQAPDMDTLQIHVMECIE |
Molecular Weight | 48 kDa |
Purity | >= 85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |