Recombinant Human Leucine-Rich Glioma-Inactivated Protein 1 (LGI1) Protein (His&Myc)

Name: Recombinant Human Leucine-Rich Glioma-Inactivated Protein 1 (LGI1) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-01725P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Leucine-Rich Glioma-Inactivated Protein 1 (LGI1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O95970
Target Symbol	LGI1
Synonyms	Epitempin-1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	TEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA
Expression Range	224-557aa
Protein Length	Partial
Mol. Weight	46.3 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Regulates voltage-gated potassium channels assembled from KCNA1, KCNA4 and KCNAB1. It slows down channel inactivation by precluding channel closure mediated by the KCNAB1 subunit. Ligand for ADAM22 that positively regulates synaptic transmission mediated by AMPA-type glutamate receptors. Plays a role in suppressing the production of MMP1/3 through the phosphatidylinositol 3-kinase/ERK pathway. May play a role in the control of neuroblastoma cell survival.
Subcellular Location	Secreted. Cell junction, synapse. Note=Isoform 1 but not isoform 2 is secreted. Isoform 1 is enriched in the Golgi apparatus while isoform 2 accumulates in the endoplasmic reticulum.
Database References	HGNC: 6572 OMIM: 600512 KEGG: hsa:9211 STRING: 9606.ENSP00000360472 UniGene: Hs.533670
Associated Diseases	Epilepsy, familial temporal lobe, 1 (ETL1)
Tissue Specificity	Predominantly expressed in neural tissues, especially in brain. Expression is reduced in low-grade brain tumors and significantly reduced or absent in malignant gliomas. Isoform 1 is absent in the cerebellum and is detectable in the occipital cortex and h

Gene Functions References

the LGI1-ADAM22 complex functions as the trans-synaptic machinery for precise synaptic transmission PMID: 29670100
The data obtained strongly suggest the possibility of gene LGL1 inactivation by epigenetic mechanism: modified < >. PMID: 30188624
The clinical phenotypes of anti-LGI1 encephalitis and anti-Caspr2 encephalitis have been described in more detail including data on treatment and long-term follow-up. Lumping patients with anti-LGI1, anti-Caspr2 antibodies or lacking both, should be considered obsolete--{REVIEW} PMID: 28248701
Autosomal dominant epilepsy with auditory features family due to a novel LGI1 mutation. PMID: 26459092
Clinical analysis of a lateral temporal lobe epilepsy cohort from Turkey and genetic contribution of LGI1 to autosomal dominant lateral temporal lobe epilepsy phenotype PMID: 26773249
Report of three novel LGI1 mutations, a microdeletion of exon 2 and two missense mutations in exon 8, occurring in two autosomal dominant lateral temporal epilepsy families and in one sporadic patient with lateral temporal epilepsy PMID: 25616465
study found no cryptic imbalances were in LGI1 in partial epilepsy with auditory features (PEAF) patients, suggesting that LGI1 microdeletions are not a frequent cause of PEAF PMID: 24721199
The Multiplex ligation-dependent probe amplifications analysis did not reveal any pathogenic changes in the LGI1 gene. Chromosomal rearrangements involving the LGI1 gene were not identified in our series of familial or sporadic LTE. PMID: 24315022
A new LGI1 missense mutation is identified in a large Korean family with autosomal dominant lateral temporal lobe epilepsy. PMID: 24177143
Seven LGI1-affected individuals report auditory aura and one visual aura; three families with autosomal dominant epilepsy and auditory features have novel LGI1 mutations. PMID: 24206907
Downregulation of LGI1 promotes tumor metastasis in esophageal squamous cell carcinoma. PMID: 24510112
This study expands the phenotypic spectrum associated with Autosomal dominant lateral temporal lobe epilepsy due to LGI1 mutation and underlines the need for more systematic evaluation of Attention-deficit hyperactivity disorder and related symptoms. PMID: 23651915
The LGI1-ADAM22 interaction is neutralized by autoantibodies to epilepsy-related LGI1 in limbic encephalitis. PMID: 24227725
This study demonistrated that Low penetrance of autosomal dominant lateral temporal epilepsy in Italian families without LGI1 mutations. PMID: 23621105
Cerebrocortical manifestations are recorded in 76% of patients with LGI1 immunoglobulin G (IgG) seropositivity. PMID: 23407760
Antibodies bind to proteins complexed with voltage-gated potassium channel (VGKC) complex in two patients with LG11-antibody encephalitis. PMID: 22744657
This is the first microdeletion affecting LGI1 identified in autosomal dominant lateral temporal epilepsy. PMID: 22496201
The N-terminal leucine-rich repeat region of the LGI1 gene is likely to play a major role in pathogenesis of autosomal dominant partial epilepsy with auditory features. PMID: 22323750
LGI1, a secreted synaptic protein mutated to cause human partial epilepsy, regulates a seizure-induced circuit response by redistributing Kv4.2 channels to the neuronal surface in a transgenic mouse model. PMID: 22122031
mutations in autosomal dominant lateral temporal epilepsy with low penetrance and effects on protein secretion PMID: 21504429
A possible arrangement between the two domains and identifies a possible ADAM protein binding site in the beta-propeller domain and another protein binding site in the leucine-rich repeat domain, is suggested. PMID: 21479274
Data report a family with temporal lobe epilepsy characterized by psychic symptoms associated with a novel LGI1 mutation. PMID: 21444903
The LGI family members is responsible for phenotypically similar, mechanistically related but genotypically distinct forms of epilepsy. PMID: 20863412
The target antigen of antibodies in patients with limbic encephalitis previously attributed to voltage-gated potassium channels is in fact LGI1, a secreted neuronal protein that functions as a ligand for two epilepsy-related proteins, ADAM22 and ADAM23. PMID: 20580615
These findings suggest that LGI1 mutations in Japanese ADLTE families may not be uncommon, and that diverse clinical phenotypes make adequate diagnosis of ADLTE difficult when only based on clinical information. PMID: 19780791
Data suggest that LGI1 binding to ADAM23 is necessary to correctly pattern neuronal morphology, and altered anatomical patterning contributes to autosomal dominant partial epilepsy with auditory features. PMID: 19796686
LGI1 may be an important molecule for the arrest of prostate cancer cell invasion and possibly a biomarker for early detection of prostate hyperplasia. PMID: 19778537
These observations support a role for LGI1 in synapse vesicle function in neurons. PMID: 19387870
mutations cause autosomal-dominant partial epilepsy with auditory features PMID: 11810107
Mutations in LGI1 causes autosomal dominant lateral temporal epilepsy PMID: 11978770
Shares a homology domain with MASS1, a mouse epilepsy protein PMID: 12095917
LGI1 is mutated in familial temporal lobe epilepsy characterized by aphasic seizures PMID: 12205652
A novel mutation in the Lgi1 signal peptide is predicted to interfere with protein cell sorting, resulting in altered processing. PMID: 12601709
A novel F318C substitution alters a highly conserved residue in a predicted repeat domain of LGI1 which may participate in the development of the "autosomal dominant partial epilepsy with auditory features" phenotype. PMID: 12771268
LGI1 has a role in cell growth and neoplasm invasiveness in glioma cells PMID: 12821932
novel mutations in LGI1 gene are traced to temporal epilepsy. PMID: 15009222
Loss of LGI1 expression may be an important event in the progression of gliomas that leads to a more invasive phenotype in these cells PMID: 15047712
In temporal lobe epilepsy, mutations in LGI1 are specific for autosomal dominant partial epilepsy with auditory features {ADPEAF} but do not occur in all families; ADPEAF is genetically heterogeneous PMID: 15079010
LGI1 mutations are a common cause of autosomal dominant partial epilepsy with auditory features[ADPEAF]. Current data do not reveal a clinical feature clearly predictive of which ADPEAF families have a mutation PMID: 15079011
that the evidence supporting the tumor suppressor role of LGI1 in malignant gliomas is weak and that further work is necessary to establish LGI1 role in glial cells PMID: 15827762
LGI1 controls neuronal cell survival PMID: 16518856
No analyzed polymorphisms modified susceptibility in either the familial or sporadic forms of this partial epilepsy. PMID: 16707245
Two protein isoforms encoded by LGI1/epitempin are differentially expressed in human brain; higher expression levels in lateral temporal cortex may underlie the susceptibility of this brain region to epileptogenic effects of LGI1/epitempin mutations. PMID: 16787412
LGI1 is a secreted protein and suggest that LGI1-related epilepsy results from a loss of function. PMID: 17296837
We found a structural anomaly of the left lateral temporal lobe in epilepsy due to mutated LGI1. PMID: 17875918
no mutations in the leucine-rich, glioma-inactivated 1 (LGI1) gene linked to familial or sporadic lateral temporal epilepsy were found PMID: 18355961
A novel loss-of-function mutation in LGI1 provides further evidence that mutations in LGI1 hamper secretion of the Lgi1 protein, thereby precluding its normal function. PMID: 18625862
About two-thirds of individuals who inherit a mutation in LGI1 will develop epilepsy. This probably overestimates the true penetrance in the population because it is based on data from families containing multiple affected individuals. PMID: 18711109
Both truncating and missense mutations appear to prevent secretion of mutant proteins, suggesting a loss of function effect of mutations. PMID: 19191227
In a family in which three patients also experienced migraine-like episodes we found a novel three base-pair deletion (c.377_379delACA), resulting in the deletion of an asparagine residue in the second leucine-rich repeat. PMID: 19268539

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.