Recombinant Human Mucin-17 (MUC17) Protein (His), Active

Name: Recombinant Human Mucin-17 (MUC17) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05733P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody , the EC 50 is 0.9057-1.259 ng/mL.

Collections: Car-nk targets proteins, Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Mucin-17 (MUC17) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody , the EC50 is 0.9057-1.259 ng/mL.
Uniprotkb	Q685J3
Target Symbol	MUC17
Synonyms	(MUC-17)(Small intestinal mucin-3)(MUC-3)
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-10His
Target Protein Sequence	RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL
Expression Range	4131-4390aa
Protein Length	Partial
Mol. Weight	32.0kDa
Research Area	Other
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Probably plays a role in maintaining homeostasis on mucosal surfaces.
Subcellular Location	[Isoform 1]: Cell membrane; Single-pass membrane protein.; [Isoform 2]: Secreted. Cell membrane.
Database References	HGNC: 16800 OMIM: 608424 KEGG: hsa:140453 STRING: 9606.ENSP00000302716 UniGene: Hs.271819
Tissue Specificity	Expressed almost exclusively in the intestine. Expression is especially high in both the duodenum and transverse colon. Expressed in mature absorptive cells of the small intestinal villi. No expression is detected in goblet cells. Highly expressed in panc

Gene Functions References

MUC17 polymorphisms are involved in endometriosis development and the associated infertility in the Taiwanese population. PMID: 26285705
Carbachol stimulated enterocyte MUC17 endocytosis is concomitant with NHE3 internalization and CFTR membrane recruitment. PMID: 23784542
The HIF1alpha-mediated hypoxic signal pathway contributes to MUC17 expression, and DNA methylation of hypoxia responsive element could be a determinant of the hypoxic inducibility of MUC17 in pancreatic cancer cells. PMID: 22970168
Both native and exogenous MUC17 play a role in attachment and invasion of enteroinvasive E. coli in colonic cell lines and in maintaining epithelial barrier function. PMID: 21393431
Hypomethylation status in the MUC17 promoter could be a novel epigenetic marker for the diagnosis of Pancreatic ductal adenocarcinomas. PMID: 20926598
Results indicate that the potential protective effects of this membrane-bound mucin are primarily or secondarily diminished in inflammatory and neoplastic conditions. PMID: 20702471
augments intestinal cell restitution and enhances healing of experimental colitis in mice PMID: 20211273
The authors demonstrate that apically atypical enteropathogenic Escherichia coli infection is followed by increased production of secreted MUC2 and MUC5AC mucins and membrane-bound MUC3 and MUC4 mucins. PMID: 20065027
sequence homology & chromosome mapping PMID: 11855812
surface localization of the smaller subunit of MUC17 is dependent on its N-glycosylation status PMID: 12888891
The MUC17 sequence has been extended toward its 5'-extremity to complete the sequence and localize the promoter and regulatory elements. PMID: 16737958
Pdzk1 plays a specific role in stabilizing Muc17 in the apical membrane of small intestinal enterocytes. PMID: 17990980

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.