Recombinant Human OX40L/TNFSF4 Protein
Beta LifeScience
SKU/CAT #: BLA-10707P
Recombinant Human OX40L/TNFSF4 Protein
Beta LifeScience
SKU/CAT #: BLA-10707P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | CD 134L CD 252 CD134 ligand CD134L CD252 CD252 antigen glycoprotein 34 kd Glycoprotein Gp34 GP34 OX-40L OX40 antigen ligand OX40 ligand OX40L TAX transcriptionally-activated glycoprotein 1 TNFL4_HUMAN Tnfsf4 Tumor necrosis factor (ligand) superfamily member 4 Tumor necrosis factor ligand superfamily member 4 TXGP1 |
Description | Recombinant Human OX40L/TNFSF4 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSAL QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGF YLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVY LNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |