Recombinant Human OX40L/TNFSF4 Protein

Beta LifeScience SKU/CAT #: BLA-10709P

Recombinant Human OX40L/TNFSF4 Protein

Beta LifeScience SKU/CAT #: BLA-10709P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P23510
Synonym CD 134L CD 252 CD134 ligand CD134L CD252 CD252 antigen glycoprotein 34 kd Glycoprotein Gp34 GP34 OX-40L OX40 antigen ligand OX40 ligand OX40L TAX transcriptionally-activated glycoprotein 1 TNFL4_HUMAN Tnfsf4 Tumor necrosis factor (ligand) superfamily member 4 Tumor necrosis factor ligand superfamily member 4 TXGP1
Description Recombinant Human OX40L/TNFSF4 Protein was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGF YLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVY LNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Molecular Weight 30 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity TNFSF4 Protein binds to Human CD134 (OX40). It activates T cell proliferation and delays neutrophil apoptosis.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -80°C.

Target Details

Target Function Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
Subcellular Location Membrane; Single-pass type II membrane protein.
Protein Families Tumor necrosis factor family
Database References
Associated Diseases Systemic lupus erythematosus (SLE)

Gene Functions References

  1. It is concluded that the rs3850641 SNP is significantly associated with the breast cancer susceptibility in Iranian population. PMID: 29949525
  2. TNFSF4 SNPs rs844648, rs844648 and rs704840 were associated with an increased risk of neuromyelitis optica spectrum disorders in Chinese population. PMID: 29032462
  3. The study suggests that the TNFSF4 gene may be involved in the susceptibility to Vogt-Koyanagi-Harada disease and Behcet's Disease in Han Chinese PMID: 27872495
  4. present study suggests a novel association between specific TNFSF4 and BLK gene polymorphisms and allergic rhinitis risk. PMID: 28713926
  5. Data suggest that tumour necrosis factor superfamily 4 (TNFSF4) rs704840 could be the potential systemic lupus erythematosus (SLE) risk factors in the Malaysian population. PMID: 27519474
  6. House dust mite sublingual immunotherapy downregulated Th2-type immune responses mediated by the TSLP-OX40L signaling pathway in patients with persistent moderate to severe allergic rhinitis. PMID: 27012942
  7. OX40 and OX40L formed a functional complex, which may facilitate signal transduction from OX40L to OX40 and contribute to the pathogenesis of Grave's disease. PMID: 27107937
  8. The polymorphisms of the TNFSF4 gene may contribute to the susceptibility to pathogenesis of early-Onset Autoimmune Thyroid Diseases and Hypothyroidism of Hashimoto's Thyroiditis. PMID: 27556446
  9. the SNPs in TNFSF4 and FAM167A-BLK may be involved in asthma and allergic rhinitis gene risk in the Han Chinese cohort. PMID: 27088737
  10. Given the discovery cohort, functional data, and importance of TNFSF4 in infection clearance, TNFSF4C may associate with outcomes and warrants future studies. PMID: 26348892
  11. Review/Meta-analysis: TNFSF4 (rs3850641) polymorphisms is not associated with coronary heart disease risk. PMID: 27008001
  12. Study showed that the A allele of the rs7518045 and haplotype rs3861950C-rs17346501C-rs7518045A-rs1234313G in the TNFSF4 gene were associated with decreased risk for myocardial infarction in a Chinese Han population. PMID: 26125814
  13. higher expression in patients with nasal polyposis compared with patients with chronic rhinosinusitis without nasal polyps PMID: 24583911
  14. contributes to the aberrant T Follicular Helper response in systemic lupus erythematosus PMID: 26070486
  15. Data indicate that soluble OX40 and sOX40L plasma levels are increased in early rheumatoid arthritis patients. PMID: 25359291
  16. Report role of TNFSF4 genetic variants in confering risk of systemic lupus erythematosus in Chinese population. PMID: 24091983
  17. There were no significant associations between rs1234313, rs1234314 and rs17568 and atherosclerotic cerebral infarction risk in a Han Chinese population. PMID: 24595151
  18. Blocking of the interaction between OX40 and OX40L in vitro inhibited production of Thl and Th2 type cytokines in acute renal allograft rejection. PMID: 23953582
  19. TNFSF4 gene polymorphism rs3861950, but not rs3850641, is associated with the risk of atherosclerosis CI in a Chinese population. PMID: 23184501
  20. The results of a meta-analysis suggest that the TNFSF4 rs2205960 polymorphism may confer susceptibility to systemic lupus erythematosus (SLE) in different populations and that the TNFSF4 rs1234315 polymorphism is associated with susceptibility to SLE in Asians. PMID: 22850862
  21. Our data firstly replicated the association of TNFSF4 with renal disorder in SLE patients in the Chinese population, which supported that TNFSF4 may act as a marker of lupus nephritis PMID: 23936824
  22. Our data confirm a global signal at TNFSF4 and a role for the expressed product at multiple stages of lymphocyte dysregulation during SLE pathogenesis PMID: 23874208
  23. The expression levels of OX40 and OX40L were higher in pSS patients. PMID: 23948416
  24. TNFSF4 may have little significance as a common genetic component of Sjogren's syndrome and primary biliary cirrhosis in the Chinese Han population. PMID: 23622253
  25. OX40L expression can be used as a marker to evaluate antiviral treatment efficacy and extend the notion that enhancement of OX40L expression could be a good way for immunotherapy in chronic hepatitis C patients. PMID: 23589118
  26. results suggest that the rs3850641 and rs17568 polymorphisms in the OX40L and OX40 genes are associated with some of the lipid and lipoprotein variations in subjects with endogenous HTG PMID: 23216302
  27. findings provide evidence for the involvement of OX40 and OX40L in the pathogenesis of AD though they are not specific to AD and in vitro results suggest complex interaction PMID: 22646697
  28. The simultaneous expression of both OX40 and its ligand OX40L in idiopathic inflammatory myopathies suggests that they might participate in disease pathogenesis PMID: 23469620
  29. data primarily indicates that rs3850641 of OX40L gene contributes to sporadic breast carcinogenesis in a northeast Chinese Han population. PMID: 22870213
  30. This meta-analysis confirms that TNFSF4 polymorphisms are associated with susceptibility to systemic lupus erythematosus in Asians and Europeans PMID: 22820624
  31. We confirm TNFSF4 as an systemic sclerosis susceptibility gene and rs2205960 as a putative causal variant with preferential association in the ACA+ subphenotype. PMID: 22422496
  32. Concentrations of sOX40L were found to be high in adult asthmatic patients and were associated with the severity of the disease. Therefore, sOX40L could be a potential infl ammatory mediator in the pathogenesis of asthma. PMID: 22760717
  33. Augmentation of OX40-OX40L signals in interferon type I receptor (IFNalphaR)-deficient transgenic mice can substantially enhance CD4+ T cell, but not CD8+ T cell primary responses. PMID: 22156349
  34. High OX40L is associated with acute coronary syndrome and stable angina. PMID: 21986129
  35. Up-regulation of OX40L may play a critical role in development of childhood atopic asthma and correlates with asthma severity. PMID: 21781408
  36. OX40 gene polymorphism may be associated with a risk of ACS in the Han Chinese population, although the association between OX40L polymorphisms and ACS requires further investigation PMID: 21476935
  37. data indicate that the TNFSF4 rs45454293T-allele is associated with lower TNFSF4 expression and increased risk of myocardial infarction PMID: 21445270
  38. Both OX40 upregulation and sOX40L increase were closely associated with Henoch-Schonlein purpura (HSP), especially HSP with nephritis. PMID: 21143648
  39. These results demonstrate for the first time that HDAC11 plays an essential role in regulating OX40L expression. PMID: 21239696
  40. Our study not only suggested that the TNFSF4 gene was associated with systemic lupus erythematosus in the Chinese Han population, but also implied that the TNFSF4 gene might also predispose multiple populations to systemic lupus erythematosus. PMID: 20012871
  41. Data show that MMP-2-conditioned dendritic cells primed naive CD4(+) T cells to differentiate into an inflammatory T(H)2 phenotype through OX40L expression and inhibition of IL-12p70 production. PMID: 21397857
  42. TNFSF4 is a susceptibility gene of coronary heart disease in Chinese Han population PMID: 21402531
  43. The data confirm the influence of TNFSF4 polymorphisms in systemic sclerosis genetic susceptibility, especially in subsets of patients positive for lcSSc and anti-centromere antibodies. PMID: 21187296
  44. our data provide an in vivo role for the OX40/OX40L system in the innate immune response during polymicrobial sepsis PMID: 20844189
  45. Polymorphisms in the TNFSF4 gene region are associated with susceptibility to systemic sclerosis and its clinical and autoantibody subsets. PMID: 19778912
  46. OX40/OX40L expression is increased in the bronchial submucosa in mild asthma, but not in moderate-to-severe disease, and is related to the degree of tissue eosinophilia and IL-4 expression. PMID: 20139223
  47. Expression of CD134 and CD134 ligand in lesional and nonlesional psoriatic skin. PMID: 12624783
  48. combined use of a vector driving the expression of OX40L with three other costimulatory molecules (B7-1, ICAM-1, and LFA-3) both enhances initial activation and then further potentiates sustained activation of nai;ve and effector T cells. PMID: 12798307
  49. An OX40L-dependent mechanism is demonstrated in plasmacytoid dendritic cell-mediated T helper cell responses; OX40L selectively induces Th2-type immune responses by promoting CD4+ T cells to secrete IL-4, IL-5, and IL-13. PMID: 15034038
  50. Elucidation of cross-talk between OX40 and OX40L could be very important in understanding interaction of cells present in inflamed airways of asthma. PMID: 15100674

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed