Recombinant Human Reduced Folate Transporter (SLC19A1) Protein (His&Myc)

Name: Recombinant Human Reduced Folate Transporter (SLC19A1) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-00532P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - transmembrane proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Reduced Folate Transporter (SLC19A1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P41440
Target Symbol	SLC19A1
Synonyms	(FOLT)(Cyclic dinucleotide:anion antiporter SLC19A1)(Folate:anion antiporter SLC19A1)(Intestinal folate carrier 1)(IFC-1)(Placental folate transporter)(Reduced folate carrier protein)(RFC)(hRFC)(Reduced folate transporter 1)(RFT-1)(Solute carrier family 19 member 1)(hSLC19A1)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	DVRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ
Expression Range	420-591aa
Protein Length	Partial
Mol. Weight	25.5 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transporter that mediates the import of reduced folates and a subset of cyclic dinucleotides. Has high affinity for N5-methyltetrahydrofolate, the predominant circulating form of folate. Also able to mediate the import of antifolate drug methotrexate. Acts as an importer of immunoreactive cyclic dinucleotides, such as cyclic GMP-AMP (2'-3'-cGAMP), an immune messenger produced in response to DNA virus in the cytosol, and its linkage isomer 3'-3'-cGAMP. Mechanistically, acts as an antiporter, which export of intracellular organic anions to facilitate uptake of its substrates. 5-amino-4-imidazolecarboxamide riboside (AICAR), when phosphorylated to AICAR monophosphate, can serve as an organic anion for antiporter activity.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Protein Families	Reduced folate carrier (RFC) transporter (TC 2.A.48) family
Database References	HGNC: 10937 OMIM: 600424 KEGG: hsa:6573 STRING: 9606.ENSP00000308895 UniGene: Hs.736903
Tissue Specificity	Placenta, liver, and to a much smaller extent, in lung.

Gene Functions References

miR-595 acts as a phenotypic regulator of methotrexate sensitivity in CEM/C1 cells by targeting SLC19A1. PMID: 29345051
RFC, IL15 and VDR germline variants are associated with minimal residual disease in pediatric B-cell precursor ALL PMID: 27427275
We identified eight novel variants in SLC19A1 and twelve novel variants in FOLR1, FOLR2, and FOLR3. Pathogenic variants include c.1265delG in SLC19A1 resulting in an early stop codon, four large insertion deletion variants in FOLR3, and a stop_gain variant in FOLR3 PMID: 28948692
Reduced SLC19A1 expression in human adipocytes induces DNA hypermethylation, resulting in increased expression of specific proinflammatory genes, including CCL2. This constitutes an epigenetic mechanism that might link dysfunctional adipocytes to white adipose tissue inflammation and Insulin resistance. PMID: 29121255
data suggested that the RFC1 A80G G allele was an APOE 4-independent risk factor for late-onset Alzheimer's disease (AD PMID: 18258338
The presence of the genetic polymorphism of RCF1 is a maternal risk factor for Down syndrome in Brazil. PMID: 18273817
The results of this study suggest that genetic variants of methionine metabolism are associated with meningioma formation PMID: 18447718
MTHFR 677C/T and RFC1 80G/A polymorphisms may serve as predictors of toxicity during maintenance chemotherapy in childhood acute lymphoblastic leukemia or lymphoma. PMID: 18458567
Neonatal RFC1 polymorphism influenced total homocysteinein neonates PMID: 18823966
There was an association between RFC1 A80G variant and the risk of nonsymdromic cleft lip with or without palate. PMID: 19548564
the A80G polymorphism of reduced folate carrier 1 (RFC1) gene may have a role in head and neck squamous cell carcinoma PMID: 20661649
the G80A mutation in the RFC1 gene is associated with a greater risk for sporadic breast cancer and oxidative DNA damage PMID: 21113649
We demonstrated no difference in tHcy, folates, vitamin B12 levels and allelic frequencies of C677T and G80A polymorphisms in MTHFR and RFC genes between obese and no obese Tunisian children. PMID: 21681722
677T and 1298C alleles of MTHFR and G80 RFC-1 show association with hyperhomocysteinemia. PMID: 21878957
High RFC1 is associated with adenocarcinoma in non-small-cell lung carcinoma EGFR [corrected] mutation. PMID: 22729036
Data suggest that genotypes for the MTHFR C677T and RFC rs1051266 polymorphism might be associated with the risk of conotruncal heart defects. PMID: 22868813
These data suggest a role of the polymorphism G80A in RFC1 in the risk of relapse and the mortality risk in patients with acute lymphoblastic leukemia. PMID: 22914600
The presence of the mutant MTHFR 1298C and also RFC 80A was linked to a decreased risk of developing chidlhood acute lymphoid leukemia (ALL). PMID: 23336575
The combined presence of RFC1 mutant alleles and the cystathionine b-synthase homozygous mutant allele was associated with a 4.81-fold increased risk of having a child with Down syndrome (95 % CI 1.82-12.68, P = 0.0007). PMID: 23430030
Maternal RFC-1 80A>G polymorphism might be associated with an increased risk of having a birth with Down Syndrome. [Meta-analysis] PMID: 23857226
One-carbon genetic variants influence epigenetic of MHC2TA and RFC1, thus contributing to phenotypic heterogeneity of systemic lupus erythematosus. PMID: 24333266
3 biallelic polymorphic variants (rs1051266, rs4818789 and rs3788205) were selected. Results provided support suggesting role of RFC1 in NSCL/P etiology, reinforcing idea genetic predisposition to NSCL/P varies in different ethnic groups. PMID: 24942095
The frequency of RFC-1 rs1051266 (G80A) was 58.4% and 57.1% in children with nephroblastoma and neuroblastoma, respectively. Mother and child G80A genotypes play a role in the risk of neuroblastoma and nephroblastoma. PMID: 25536437
The MTHFR 677CC and GGH 401TT and CT genotypes were associated with a reduction in the number of MTX-related adverse events PMID: 25599563
this is the first study to simultaneously evaluate both DNA methylation and protein expression of all three folate transporter genes, FOLR1, PCFT, and RFC1, in colorectal cancer. PMID: 25697897
We found that the compound mutation genotypes MTHFD-G1958A, MTR-A2756G, and RFC1-G80A increased the risk of preterm birth (OR = 2.88, 95%CI = 1.08-7.72, P = 0.028). PMID: 25730024
RFC-1 80G > A gene polymorphism is not associated with methotrexate treatment response in South Indian Tamils with rheumatoid arthritis PMID: 25771854
We conclude that bearing allele G of rs1051266 polymorphism in RFC1 may contribute to increased efficacy of MTX treatment and may contribute to improved outcome in osteosarcoma patients PMID: 25778468
this meta-analysis shows that RFC1 gene polymorphism is associated with responsiveness to methotrexate therapy, but may not be associated with methotrexate toxicity in rheumatoid arthritis patients PMID: 27233001
in this study, we did not find any significant associations between Rheumatoid Arthritis or Rheumatoid Arthritis characteristics such as activity disease and polymorphisms MTRR A66G, RFC1 G80A, and MTHFR C677T and A1298C. PMID: 28994615
Genetic variants of SLC19A1 may be associated with risks for childhood ASD. PMID: 28536923
Among the analysed polymorphisms, only the reduced folate carrier 1 (RFC1; SLC19A1) gene 80G>A polymorphism influenced the survival rate in primary liver cancers. PMID: 27936032
Cognition of adults aged from 55 to 90 was associated with MTHFR, SLC19A1 gene polymorphism and serum homocysteine levels. PMID: 27783031
Polymorphisms and haplotypes of the SLC19A1 gene can be considered risk factors for idiopathic recurrent pregnancy loss. PMID: 26959650
results supported a role of the SLC19A1 gene in the etiology of Autism Spectrum Disorder, it was not a significant risk factor for the Autism Spectrum Disorder samples analyzed in this study. PMID: 27213354
We conclude that SLC46A1/PCFT and SLC19A1/RFC-1 are associated with DFS of patients with colorectal cancer and hypothesize that poor response to 5-fluorouracil plus leucovorin therapy in some patients may be linked to low expression of these genes. PMID: 26193446
SLC19A1 expression was associated with increased risk of relapse or death, and SLC19A1 expression retained prognostic significance independent of age, disease stage and MYCN amplification. PMID: 25860940
Our findings support the hypothesis that RFC1 A80G variant may contribute to non-syndromic cleft lip and palate susceptibility in a south Indian population. PMID: 24749799
the RFC-1 -43C>T, 80A>G, and 696T>C polymorphisms may be risk factors for ischemic stroke. PMID: 25659099
SLC19A1 rs1051266 GG/GA genotype is associated with first trimester fever. PMID: 24917213
SLC19A1 rs1051296 G>T, a miRNA binding site polymorphism, was associated with increased plasma methotrexate concentrations in Chinese children with acute lymphoblastic leukemia. PMID: 24927955
SLC19A1 genotype may help to identify patients with increased risk of methotrexate-related toxicity. PMID: 25124723
The reduced RFC mRNA expression in paclitaxel-resistant osteosarcoma cells may be related to the decrease in intracellular methotrexate concentration. PMID: 25078587
A significant association was detected between the MTHFR A1298C/ RFC G80A genotype and a nonpredisposition to acute lymphoblastic leukemia. PMID: 24237708
Present results do not support a role for the RFC-1 c.80G>A polymorphism as independent risk factor for sporadic AD in Italian Caucasians PMID: 24995314
SLC19A1 80G carriers had increased risk of gastrointestinal toxicity. PMID: 24350725
The molecular bases for methotrexate resistance associated with loss of SLC19A1 transport and for hereditary folate malabsorption, attributable to mutant SLC46A1, were determined (review). PMID: 24396145
No direct association was found between variant (G) allele or genotype of rs1051266 with Alzheimer disease and vascular dementia cases. Gene polymorphism was not associated with serum folate level. PMID: 24554143
Results suggest that genetic polymorphisms in MDR1 and RCF1 the toxicity but not the response of methotrexate treatment. PMID: 25074866
RFC1 80G>A is a genetic determinant of methotrexate efficacy in rheumatoid arthritis. PMID: 24782176

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.