Recombinant Human Ribonuclease 4 (RNASE4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-03415P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Ribonuclease 4 (RNASE4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-03415P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Ribonuclease 4 (RNASE4) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P34096 |
Target Symbol | RNASE4 |
Synonyms | RAB1; Ribonuclease 4; Ribonuclease A B1; ribonuclease A family member 4; Ribonuclease; RNase A family; 4; RNAS4_HUMAN; RNase 4; RNASE4; RNS4 |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | N-10His&C-Myc |
Target Protein Sequence | QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG |
Expression Range | 29-147aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 17.8 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | This RNase has marked specificity towards the 3' side of uridine nucleotides. |
Subcellular Location | Secreted. |
Protein Families | Pancreatic ribonuclease family |
Database References |
Gene Functions References
- RNASE4, STAT3, and miRNA-124 may have a regulatory association with the pathological mechanisms in Huntington's disease. PMID: 29328442
- Data show that the transcription of angiogenin (ANG) and ribonuclease 4 (RNASE4) promoter is influenced by RNA polymerase III (Pol III) elements and could be differentially regulated by an intragenic CCCTC binding factor (CTCF)-dependent chromatin loop. PMID: 24659782
- RNASE4 not only stimulates the formation of neurofilaments from mouse embryonic cortical neurons, but also protects hypothermia-induced degeneration PMID: 23143660