Recombinant Human SLC27A4 / FATP4 Protein
Beta LifeScience
SKU/CAT #: BLA-8281P
Recombinant Human SLC27A4 / FATP4 Protein
Beta LifeScience
SKU/CAT #: BLA-8281P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q6P1M0-2 |
Synonym | ACSVL 4 ACSVL4 EC 6.2.1 FATP 4 FATP4 Fatty acid transport protein 4 Fatty acid transport protein4 IPS Long chain fatty acid transport protein 4 Long chain fatty acid transport protein4 OTTHUMP00000022264 S27A4 SLC27 A4 SLC27A 4 Solute carrier family 27 (fatty acid transporter) member 4 Solute carrier family 27 member 4 Solute carrier family 27 member4 |
Description | Recombinant Human SLC27A4 / FATP4 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MPLTLSTLLQPGRIWTGRRAAEPTPGHNAAWSLSGGGAAVLQAGAETALD PGGILPVVPLLGIWRLALHPGLHQDHQAYLTGDVLVMDELGYLYFRDRTG DTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASP TGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGF DPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL |
Molecular Weight | 52 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |