Recombinant Human T-Cell Leukemia Virus 1 Envelope Glycoprotein Gp62 (ENV) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-11163P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human T-Cell Leukemia Virus 1 Envelope Glycoprotein Gp62 (ENV) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-11163P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human T-Cell Leukemia Virus 1 Envelope Glycoprotein Gp62 (ENV) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P03381 |
Target Symbol | ENV |
Synonyms | env; Envelope glycoprotein gp62; Env polyprotein) [Cleaved into: Surface protein; SU; Glycoprotein 46; gp46); Transmembrane protein; TM; Glycoprotein 21; gp21)] |
Species | Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) (HTLV-1) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | DYSPSCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSRSRR |
Expression Range | 21-312aa |
Protein Length | Partial |
Mol. Weight | 36.0 kDa |
Research Area | Metabolism |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | The surface protein (SU) attaches the virus to the host cell by binding to its receptor. This interaction triggers the refolding of the transmembrane protein (TM) and is thought to activate its fusogenic potential by unmasking its fusion peptide. Fusion occurs at the host cell plasma membrane.; The transmembrane protein (TM) acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Membranes fusion leads to delivery of the nucleocapsid into the cytoplasm. |
Subcellular Location | [Transmembrane protein]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.; [Surface protein]: Virion membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein. |