Recombinant Human Thyroid Peroxidase (TPO) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04639P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Thyroid Peroxidase (TPO) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04639P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Thyroid Peroxidase (TPO) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P07202 |
Target Symbol | TPO |
Synonyms | MSA ; PERT_HUMAN; TDH2A; Thyroid microsomal antigen; Thyroid peroxidase; Thyroperoxidase; TPO; TPX |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR |
Expression Range | 19-161aa |
Protein Length | Partial |
Mol. Weight | 17.9kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T(3) and T(4). |
Subcellular Location | Membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell surface. |
Protein Families | Peroxidase family, XPO subfamily |
Database References | |
Associated Diseases | Thyroid dyshormonogenesis 2A (TDH2A) |
Gene Functions References
- genetic association studies in population in Japan: Data suggest that SNPs in TPO (rs2071400 C/T, rs2071403 A/G) are associated with development of Hashimoto's disease and Graves' disease, but not with the prognosis of individual patients in the population studied. PMID: 28845025
- Biochemical properties of the TPO protein expressed in cancer and normal breast tissue are similar to those observed for the thyroid TPO. Nevertheless, there are some differences in comparison with the thyroid-tissue expressed protein, such as a lower N-glycan content, a slightly smaller polypeptide length, a decreased enzymatic activity, and undetectable dimer formation. PMID: 29513734
- For the first time, we have isolated thyroid peroxidase by immunocytochemistry in the granulosa cumulus cells of the human ovarian follicle, thereby supporting the hypothesis that the human ovarian follicle may be an independent thyroid-hormone producing unit. PMID: 28277109
- study to examine the relationship between the Asn698Thr (A2095C) and Thr725Pro (A2173C) polymorphisms of the TPO gene and anti-TPO levels in patients with subclinical hypothyroidism; ncreased anti-TPO antibodies were significantly associated with the A2173C polymorphism PMID: 28500830
- Low expression of TPO is associated with dilated cardiomyopathy and impaired left ventricular function accompanied by increased risk of death. PMID: 29320567
- Our findings suggest that variants inside or near TPO, ATXN2 and RASGRP1 genes are associated with HT. Identified loci are novel to HT and represent good basis for further exploration of HT susceptibility. PMID: 27268232
- Our study indicated that the prevalence of TPO mutations was 1% among studied Chinese patients with CH. A novel TPO variation c.1682C>T/p. T561M was found, thereby expanding the mutational spectrum of the gene. PMID: 27173810
- It is concluded that TPO 2173A>C polymorphism may be considered as a risk factor for developing autoimmune thyroiditis in patients with allergic rhinitis and asthma and that these patients should regularly be checked for hidden thyroiditis. PMID: 28502155
- TPO transcripts were present in both normal and breast cancer tissue samples, although the amounts in the latter were reduced. TPO levels are lower in more advanced cancers. PMID: 28575127
- Biallelic TPO mutations most commonly underlie severe congenital hypothyroidism. PMID: 27525530
- The results of the study suggest that rs11675434 SNP located near TPO is associated with the development of Graves ophthalmopathy, especially in males and patients with later age of the disease onset. PMID: 27829681
- Mutations in the TPO gene are associated with Congenital hypothyroidism and thyroid dyshormonogenesis. PMID: 26894573
- Compound heterozygous mutations in the TPO gene are associated with congenital hypothyroidism. PMID: 27135621
- Studies suggest that Thyroid Peroxidase autoantibodies in early to mid-pregnancy is associated with concurrent depression and may be predictive of depression in the postpartum period. PMID: 27011366
- a homozygous nonsense mutation (R540X) in two patients with congenital hypothyroidism; the strong genotype/phenotype correlation associated with this mutation PMID: 26777044
- Anti-thyroid peroxidase (TPO) antibodies and male gender were significantly associated with glucose impairment in patients with beta thalassemia major. PMID: 27123460
- Lower pretreatment serum CXCL10 levels are associated with thyroid dysfunction. Thyroid dysfunction prevalence increases in female patients and patients who are positive for TPOAb at baseline. PMID: 26361424
- This is the first description of a TD causing mutation in Tunisia and thus may help to develop a genetic screening protocol for congenital hypothyroidism in the studied region. PMID: 25968604
- Two novel inactivating mutations (c.1970T> C and c.2665G> T) in the TPO gene cause congenital hypothyroidism. PMID: 26174974
- function and autoantigenicity of TPO PMID: 26623656
- This study confirms the pathogenicity of Y55X mutation in two patients with congenital hypothyroidism and demonstrates that a nonsense mutation in the amino-terminal coding region of the TPO gene could totally abolish the function of the TPO enzyme leading to total iodide organification defect. PMID: 25328990
- analysis of thyroid peroxidase autoantibody levels in type 1 diabetes in discordant twin pairs PMID: 26070305
- Data show that thyroperoxidase (TPO) single nucleotide polymorphisms (SNPs) rs4927611 TT and rs732609 CC are genotypes associated with potential risk for the congenital hypothyroidism (CH). PMID: 26663066
- A single base deletion in the carboxyl-terminal coding region of the TPO gene could cause congenital hypothyroidism and helps to establish a genotype/phenotype correlation associated with the mutation. PMID: 25241611
- Molecular cloning and functional studies of wild type and mutant forms harboring missense mutations in TPO gene showed decreased activity in the three mutants, higher Km values and lower reaction efficiencies (Vmax/Km). PMID: 25576858
- The effects of inhibition of the TPO/c-MPL pathway on enhancing the chemotherapy sensitivity of AML cells. PMID: 24085601
- The detection of the novel c.670_672del and c.1186C>T alterations expand the mutation spectrum of TPO associated with thyroid dyshormonogenesis. PMID: 25564141
- The vWA and TPOX microsatellites are good candidate biomarkers in venous thromboembolism diseases and could help to elucidate their origins. PMID: 25250329
- Variable clinical phenotypes in a family with homozygous c.1159G>A mutation in the thyroid peroxidase gene. PMID: 24717978
- In conclusion, the c.2268dup mutation leads to the formation of normal and alternatively spliced TPO mRNA transcripts with a consequential loss of TPO enzymatic activity in Malaysian-Chinese patients with goitrous CH. PMID: 24745015
- The results provide insight into why individuals with thyroid autoimmunity do or do not eventually develop thyroid disease, and these markers may therefore predict which TPOAb-positives are particularly at risk of developing clinical thyroid dysfunction. PMID: 24586183
- The study suggested the possibility of TPO gene polymorphisms as a possible pathogenetic mechanism of hypothyroidism. PMID: 24420335
- presented two children with CH who were born to consanguineous parents and were homozygous carriers of a missense (G319R) TPO mutation, the mutation segregated with the disease status in the families confirming its pathogenicity PMID: 24158420
- There was shown an association of polymorphic variants of the gene DIO2 (274A > G) with elevated levels of antibodies to TPO and TPO gene (2173A > C) with elevated levels of free T4. PMID: 25306702
- Our results point to a redundant role for the propeptide sequence in TPO. It is expressed in a membrane-anchored, enzymatically active form that is insensitive to intramolecular proteolysis, and importantly is recognized by patients' autoantibodies PMID: 23668778
- One fourth of type 1 diabetes mellitus pregnant women presented with positive anti-TPO antibodies. However, the presence of anti-TPO antibodies does not seem to be related with worse metabolic control or adverse pregnancy outcome. PMID: 23985426
- 21 TPO mutations in 28 thyroid dyshormonogenesis cases were identified showing potential linkage to this locus PMID: 23236987
- Congenital goitrous primary hypothyroidism in two German families caused by novel thyroid peroxidase (TPO) gene mutations PMID: 23512414
- TPO as a gene involved in the risk of differentiated thyroid carcinoma (DTC). PMID: 23754668
- congenital goitrous hypothyroidism of the Chinese siblings was due to the TPO gene mutations (c.2268-2269 insT and c.2089 G>A) PMID: 23329183
- Data indicate that the association between miscarriage and increased anti-thyroid peroxidase antibodies (TPOAb) levels. PMID: 23672306
- Positive anti-TPO antibody in asthmatic patients may show presence of a hidden autoimmune thyroiditis in these patients. PMID: 22947910
- In a consanguineous Pakistani family with intellectual disability, Homozygosity mapping located the causative defect on chromosome 2p25.3-p25.2. Targeted next-generation sequencing revealed an intragenic deletion of 5 exons of TPO. PMID: 22387573
- analysis of how minimally invasive follicular thyroid carcinoma developed in dyshormonogenetic multinodular goiter due to thyroid peroxidase gene mutation [case report] PMID: 22435912
- the correlation between TPOab and diagnostic parameters among newly diagnosed breast cancer patients PMID: 22149743
- Findings confirm the genetic heterogeneity of TPO defects and the importance of the implementation of molecular studies to determinate the aetiology of the CH with dyshormonogenesis. PMID: 21981063
- Data suggest that in Hashimoto's thyroiditis, both antigens, TPO and thyroglobulin, are recognized by peripheral and thyroid gland infiltrating CD8-positive T-cells and are involved in thyroid destruction leading to clinical disease manifestation. PMID: 22259066
- The study identified underlying TSHR and TPO mutations in Korean patients with congenital hypothyroidism and revealed a possible relationship between imaging findings and mutation status. PMID: 21707688
- In the presence of the C allele of T1936C, Anti-TPO level was significantly increased. PMID: 22326521
- A high frequency of mutation in the TPO gene was detected in patients with congenital hypothyroidism. PMID: 22093430