Recombinant Human TLR5 Protein
Beta LifeScience
SKU/CAT #: BLA-9056P
Recombinant Human TLR5 Protein
Beta LifeScience
SKU/CAT #: BLA-9056P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O60602 |
Synonym | FLJ10052 MGC126430 MGC126431 SLEB1 TIL 3 TIL3 TLR 5 Tlr5 TLR5_HUMAN Toll like receptor 5 Toll like receptor 5 precursor Toll-like receptor 5 Toll/interleukin 1 receptor like protein 3 Toll/interleukin-1 receptor-like protein 3 |
Description | Recombinant Human TLR5 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPD VFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSF SGVSLFSLSTEGCDEEEV |
Molecular Weight | 39 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |