Recombinant Human Trypsin-3 (PRSS3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03563P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Trypsin-3 (PRSS3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03563P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Trypsin-3 (PRSS3) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P35030 |
Target Symbol | PRSS3 |
Synonyms | Brain trypsinogen; Mesotrypsin; Mesotrypsinogen; MTG; Pancreatic trypsinogen III; Protease, serine, 3; Protease, serine, 4 (trypsin 4, brain); PRSS3; PRSS4; Serine protease 3; Serine protease 4; T9; TRY3; TRY3_HUMAN; TRY4; Trypsin 3; Trypsin III; Trypsin IV; Trypsin-3; Trypsinogen 4; Trypsinogen 5; Trypsinogen IV |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN |
Expression Range | 81-303aa |
Protein Length | Partial |
Mol. Weight | 28.2kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Digestive protease that cleaves proteins preferentially after an Arg residue and has proteolytic activity toward Kunitz-type trypsin inhibitors. |
Subcellular Location | Secreted. |
Protein Families | Peptidase S1 family |
Database References | |
Tissue Specificity | Detected in pancreas and pancreatic fluid (at protein level). Expressed in pancreas and brain. Detected in ileum. |
Gene Functions References
- PRSS3 is downregulated by intragenic hypermethylation in HCC. * Epigenetic silencing of PRSS3 facilitates growth, migration, and invasion of HCC. * PRSS3 intragenic methylation has implication in diagnosis of HCC. PMID: 28844099
- PRSS3 acts as an oncogene in invasive ductal carcinoma of the breast development and progression PMID: 28423522
- Study developed a new high resolution crystal structure of mesotrypsin complexed with diminazene through a structure-based molecular docking screen that could help facilitate derivatization efforts, addressing current pan-inhibition of human trypsins through rigidification of diminazene to select for a conformation that maximizes interactions with the non-conserved Arg-193 residue. PMID: 28463992
- Data show that silencing tumor-endothelial cells (EC) for trypsinogen 4 accumulated tissue factor pathway inhibitor-2 (TFPI-2) in the matrix. PMID: 26318044
- These findings suggest that inhibitor cleavage represents a functional adaptation of mesotrypsin that may have evolved in response to positive selection pressure. PMID: 26175157
- High PRSS3 expression in EOC tissues was significantly associated with advanced FIGO stage and lymph node metastasis. PMID: 25735255
- Data suggest that mesotrypsin cleavage of Kunitz domains may contribute to cancer progression. PMID: 25301953
- Mesotrypsin generated saposins A-D from prosaposin, and mature caspase-14 contributed to this process by activating mesotrypsinogen to mesotrypsin. Knockdown of these proteases markedly down-regulated saposin A synthesis in skin equivalent models. PMID: 24872419
- extra-pancreatic trypsinogen 3 is produced by esophageal adenocarcinoma cells and activates PAR-2 in an autocrine manner. PMID: 24146905
- IFN regulatory factor 2 (Irf2) has a regulatory role in trypsinogen5 gene transcription, which is resistant to a major endogenous trypsin inhibitor, Spink3 PMID: 22042864
- Report PRSS3/mesotrypsin upregulation in breast cancer cells and identify CD109 as the functional proteolytic target of mesotrypsin. PMID: 20035377
- PRSS3 plays an important role in the progression, metastasis and prognosis of human pancreatic cancer. PMID: 20947888
- Investigation did not reveal an association between PRSS3 variants and chronic pancreatitis. PMID: 20484962
- Because mesotrypsin is resistant to naturally occurring trypsin inhibitors, confined expression of the isoforms of mesotrypsinogens and enteropeptidase may indicate that mesotrypsin is involved in keratinocyte terminal differentiation PMID: 19924134
- Processing by mesotrypsin may ablate the protease inhibitory function of APP/protease nexin 2 in vivo and may also modulate other activities of APP/protease nexin 2 that involve the Kunitz domain. PMID: 19920152
- X-ray structure in complex with the inhibitor benzamidine at 1.7 A resolution; crystal structure reveals basis for inhibitor resistance PMID: 11827488
- biological function of human mesotrypsin is digestive degradation of trypsin inhibitors PMID: 14507909
- The results classify E32del mesotrypsinogen as a frequent polymorphic variant, which is not associated with chronic alcoholic pancreatitis PMID: 15855826
- PRSS3 promoter methylation is associated with advanced bladder cancer PMID: 15987713
- we determined the promoter hypermethylation status of PRSS3 in a case series study of primary NSCLC, and found methylation of this gene to be common, occurring in 53% (86 of 166) of tumors examined. PMID: 16013053
- Results suggest that human trypsin 4 may be one of the candidate proteases involved in the pathomechanism of multiple sclerosis via cleavage of myelin basic protein. PMID: 16412431
- analysis of structural rearrangement during the acylation step in human trypsin 4 on 4-methylumbelliferyl 4-guanidinobenzoate substrate analogue PMID: 16492676
- mesotrypsin cannot activate pancreatic zymogens, but might activate certain proteinase-activated receptors because of its thrombin-like subsite specificity; alpha1AT Pittsburgh is an effective mesotrypsin inhibitor PMID: 16759229
- human trypsinogen 4 is widely but unevenly distributed in the human brain. It is localized in neurons and glial cells, predominantly in astrocytes & the extracellular matrix. PMID: 17406981
- trypsin IV and p23 are inhibitor-resistant trypsins that can cleave and activate PARs, causing PAR(1)- and PAR(2)-dependent inflammation and PAR(2)-dependent hyperalgesia. PMID: 17623652
- This study reveals enhanced mRNA expression of trypsinogen IV and SERT and a higher 5-HT content in the small intestine of IBS patients compared to healthy subjects. PMID: 18363639
- Absence of mesotrypsinogen gene (PRSS3) copy number variations in patients with chronic pancreatitis. PMID: 18665091
- Here, we report that nexin-1 inhibits trypsin-4, and forms stable complexes only with this trypsin-isoenzyme. This result suggests that nexin-1 could modulate trypsin activity in brain where both nexin-1 and trypsin-4 are expressed. PMID: 19249338