Recombinant Influenza A Polymerase acidic Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11438P
Recombinant Influenza A Polymerase acidic Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11438P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Influenza A |
Accession | Q9IQ47 |
Description | Recombinant Influenza A Polymerase acidic Protein (His tag) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKT RLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNF SSLENFRAYVDGFEPNGYIEGKLS |
Molecular Weight | 19 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Plays an essential role in viral RNA transcription and replication by forming the heterotrimeric polymerase complex together with PB1 and PB2 subunits. The complex transcribes viral mRNAs by using a unique mechanism called cap-snatching. It consists in the hijacking and cleavage of host capped pre-mRNAs. These short capped RNAs are then used as primers for viral mRNAs. The PB2 subunit is responsible for the binding of the 5' cap of cellular pre-mRNAs which are subsequently cleaved after 10-13 nucleotides by the PA subunit that carries the endonuclease activity. |
Subcellular Location | Host cytoplasm. Host nucleus. |
Protein Families | Influenza viruses PA family |