Recombinant Limulus clotting factor c Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9811P
Recombinant Limulus clotting factor c Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9811P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Accession | P28175 |
Description | Recombinant Limulus clotting factor c Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | IWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVT YSATAEIIDPSQFKIYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNL NFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNEN NTYSEMIQQAVLPVVAASTCEEGYKEADLPLTVTENMFCAGYKKGRYDAC SGDSGGPLVFADDSRTERRWVLEGIVSWGSPSGCGKANQYGGFTKVNVFL SWIRQFI |
Molecular Weight | 34 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | This enzyme is closely associated with an endotoxin-sensitive hemolymph coagulation system which may play important roles in both hemostasis and host defense mechanisms. Its active form catalyzes the activation of clotting factor B. |
Subcellular Location | Secreted. |
Protein Families | Peptidase S1 family |
Database References | KEGG: ag:BAA14315 |
Tissue Specificity | Expressed in hemocytes (at protein level). |