Recombinant Mouse C5a Protein
Beta LifeScience
SKU/CAT #: BLA-12526P
Recombinant Mouse C5a Protein
Beta LifeScience
SKU/CAT #: BLA-12526P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Description | Recombinant Mouse C5a Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEEQAAKYKHSVPK KCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPH KPVQLGR |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycle. |