Recombinant Mouse CD200 / OX2 Protein
Beta LifeScience
SKU/CAT #: BLA-10909P
Recombinant Mouse CD200 / OX2 Protein
Beta LifeScience
SKU/CAT #: BLA-10909P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | O54901 |
Synonym | Antigen identified by monoclonal antibody MRC OX 2 CD200 CD200 antigen CD200 molecule MOX1 MOX2 MRC MRC OX 2 antigen My033 OX 2 OX 2 membrane glycoprotein precursor OX-2 membrane glycoprotein OX2G OX2G_HUMAN |
Description | Recombinant Mouse CD200 / OX2 Protein was expressed in CHO cells. It is a Protein fragment |
Source | CHO cells |
AA Sequence | QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSK THGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQK VSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIE NSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLD KGFWFS |
Purity | >= 98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Shows the biological function of theCD200 / OX2 moiety and exerts a prolonged circulating halflife caused by the modified Fc domain. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Database References | STRING: 10090.ENSMUSP00000130518 UniGene: Mm.245851 |