Recombinant Mouse CD226 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10925P
Recombinant Mouse CD226 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10925P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q8K4F0 |
Synonym | adhesion glycoprotein CD226 CD226 antigen CD226 molecule CD226_HUMAN DNAM 1 DNAM-1 DNAM1 DNAX accessory molecule 1 platelet and T cell activation antigen 1 PTA1 T lineage specific activation antigen 1 antigen TLiSA1 |
Description | Recombinant Mouse CD226 Protein (His tag) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNH NMHIESNYLHRVHFL NSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEI AAPSDSYLSAEPGQD VTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRS NCSQGSMKSILIIPN AMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILPHHHHHH |
Molecular Weight | 28 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |