Recombinant Mouse CD73 Protein (His tag)

Name: Recombinant Mouse CD73 Protein (His tag)
Brand: Beta LifeScience
SKU: BLA-11068P
Availability: InStock

Collections: Car-nk targets proteins, Cluster of differentiation (cd) proteins, Featured cd protein molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	Q61503
Synonym	5' NT 5' nucleotidase (CD73) 5' nucleotidase precursor 5' nucleotidase, ecto 5' nucleotidase, ecto (CD73) 5'-NT 5'-nucleotidase 5NTD_HUMAN CD73 CD73 antigen E5NT Ecto 5' nucleotidase Ecto-5'-nucleotidase eN eNT NT NT5 NT5E NTE Purine 5 Prime Nucleotidase
Description	Recombinant Mouse CD73 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment
Source	Baculovirus infected insect cells
AA Sequence	WELTILHTNDVHSRLEQTSDDSTKCLNASLCVGGVARLFTKVQQIRKEEP NVLFLDAGDQYQGTIWFTVYKGLEVAHFMNILGYDAMALGNHEFDNGVEG LIDPLLRNVKFPILSANIKARGPLAHQISGLFLPSKVLSVGGEVVGIVGY TSKETPFLSNPGTNLVFEDEISALQPEVDKLKTLNVNKIIALGHSGFEMD KLIAQKVRGVDIVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTADDGRQVP VVQAYAFGKYLGYLKVEFDDKGNVITSYGNPILLNSSIPEDATIKADINQ WRIKLDNYSTQELGRTIVYLDGSTQTCRFRECNMGNLICDAMINNNLRHP DEMFWNHVSMCIVNGGGIRSPIDEKNNGTITWENLAAVLPFGGTFDLVQL KGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDINRKPWNRVVQLEVLC TKCRVPIYEPLEMDKVYKVTLPSYLANGGDGFQMIKDELLKHDSGDQDIS VVSEYISKMKVVYPAVEGRIKFSLEHHHHHH
Molecular Weight	59 kDa including tags
Purity	>90% SDS-PAGE.Purified by using conventional chromatography techniques.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Specific activity is > 8,000 pmol/min/ug, and is defined as the amount of enzyme that hydrolyzes 1.0 pmole of Adenosine 5- monophosphate to phosphate per minute per minute at pH 7.5 at 25C.
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

Target Details

Target Function	Hydrolyzes extracellular nucleotides into membrane permeable nucleosides.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families	5'-nucleotidase family
Database References	KEGG: mmu:23959 STRING: 10090.ENSMUSP00000034992 UniGene: Mm.244235

Gene Functions References

Deletion of CD73 in mice leads to aortic valve dysfunction similar to that induced by high-fat diet suggesting important role of this surface protein in maintaining heart valve integrity. PMID: 28192180
We establish that the mouse Nt5e minimal promoter transcriptional activity is negatively regulated by an Elf2-like Ets-related transcription factor in activated mouse liver myofibroblasts PMID: 28667437
CD73 derived adenosine production slows down migration of Langerin+ dendritic cells from skin to lymph nodes. This may be a crucial mechanism to avoid over boarding immune reactions against haptens. PMID: 28743609
Compared to adults, young WT mice failed to control S. pneumoniae infection after vaccination and this was associated with lower levels of CD73 on innate B cells. We hypothesized that pharmacological activation of A2a receptor may improve Pneumovax 23 immunization in young WT mice PMID: 29377929
The 5'-ectonucleotidase CD73 has a key role in regulating macrophage immune responses during efferocytosis by converting AMP released from apoptotic cells into adenosine to suppress multiple pro-inflammatory cytokines. PMID: 28060378
findings demonstrate the critical role of CD73 in the regulation of infection by the enteric pathogen Salmonella and implicate adenosine as an important host-derived factor that mediates host-microbe interaction PMID: 28717030
Data show that AMP deaminase 3 (Ampd3)-/-/5'-nucleotidase (CD73)-/- knockout mice are more sensitive to AMP-induced hypometabolism than mice with a single enzyme deficiency, which are more sensitive than wild type. PMID: 28746349
This study evaluated the role of CD73 in the accumulation and adhesion of pulmonary macrophages in response to thoracic irradiation. PMID: 28325757
Deletion of CD39 and CD73 or both caused an inhibition of the microglia ramified phenotype in the brain with a reduction in the length of processes, branching frequency and number of intersections with Sholl spheres. In vitro, unlike wild-type microglia, cd39-/- and cd73-/- microglial cells were less complex and did not respond to ATP with the transformation into a more ramified phenotype. PMID: 28376099
CD73 expression is regulated during experimental autoimmune encephalomyelitis, this enzyme is not absolutely required to either promote or limit Th17 cell expansion or experimental autoimmune encephalomyelitis severity. PMID: 28288184
High NT5E expression is associated with Radiation-Induced Lung Fibrosis. PMID: 26921334
Ablation of CD73 minimally effects in vivo thrombosis, but increased CD39 expression on hematopoietic-derived cells, especially monocytes, attenuates in vivo arterial thrombosis. PMID: 27417582
CD73 on T cells plays an important anti-inflammatory role in transverse aortic constriction-induced heart failure PMID: 28404626
In this study, we investigated whether blockade of the A2A adenosine receptor with a selective antagonist and a CD73 inhibitor may increase the efficacy of a dendritic cell-based cancer vaccine PMID: 28349824
Data indicate that adenosine and CGS21680 upregulate CD39 and CD73 via E2F-1 and CREB. PMID: 27430240
CD73-siRNA-loaded ChLa NPs may be considered as a promising therapeutic tool for cancer therapy; however, further in vivo investigations are necessary PMID: 26733167
CD73/adenosine pathway involves the immunomodulatory function of mesenchymal stem cells in autoimmune responses. PMID: 26650818
CD73 facilitates AS by promoting migration, proliferation, and foam cell transformation of vascular smooth muscle cells and elevating serum lipid levels. PMID: 26506509
Low CD73 expression plays a role in melanoma progression. PMID: 26545615
These data reveal a novel function of CD73 ectonucleotidase in arresting CD8(+) T-cell differentiation and support the idea that CD73-driven adenosine production by Tc17 cells may promote stem cell-like properties in Tc17 cells. PMID: 26331349
gammadelta T cells expressed different CD73 amounts in different stages of experimental autoimmune uveitis. Low CD73 on gammadelta T cells enhanced Th17 response-promoting activity. Failure to express CD73 decreased enhancing and suppressive effects of gammadelta T cells. PMID: 26919582
Activation of A3, A2A and A1 Adenosine Receptors in CD73-Knockout Mice Affects B16F10 Melanoma Growth, Neovascularization, Angiogenesis and Macrophage Infiltration PMID: 26964090
CD73 activity from any host cell type is not required for the monocyte/macrophage polarization in the peritoneum towards a pro- or an anti-inflammatory phenotype in vivo PMID: 26258883
CD73 is not necessary for development of acute lung injury following influenza A virus infection. PMID: 26432867
The ecto-5'-nucleotidase derived extracellular formation of adenosine does not contribute substantially to adenosine's well known cardioprotective effect in early phase ischemic preconditioning. PMID: 26261991
CD73 expression was downregulated during acute infection with T. gondii, leading to impaired capacity to produce adenosine. PMID: 25389034
Expression of NPP1 and 5'-nucleotidase by valve interstitial cells promotes the mineralization of the aortic valve through A2aR and a cAMP/PKA/CREB pathway. PMID: 25644539
The CD73 deficiency significantly increased the levels of proinflammatory cytokines in mice. PMID: 25805696
our results support the view that CD73 fine-tunes antimycobacterial immune responses. PMID: 26150535
CD73 expression attenuates inflammation during murine Salmonellosis and impairs immunity, leading to increased bacterial colonization and prolonged infection. PMID: 24670982
CD73 is dispensable for normal CD8+ T-cell differentiation and function PMID: 25490556
The mouse model deficient in CD73, with other targeted mutant mice with vascular mineralization, attests to the presence of a complex pro-mineralization/anti-mineralization network that prevents ectopic tissue mineralization. PMID: 25486201
In the urothelium of animals with bladder cancer there was an increase in the expression of ecto-5'-nucleotidase. PMID: 24464643
Data show that CD73 (5' nucleotidase) deficiency resulted in greater disease incidence. PMID: 25681339
the absence of CD73-generated adenosine led to the increased susceptibility to Toxoplasma gondii infection in CD73 knockout mice. PMID: 25452548
CD73 enhances endothelial barrier function and sprouting in blood but not lymphatic vasculature. PMID: 25402681
Tetraspanin CD9 and ectonucleotidase CD73 identify an osteochondroprogenitor population with elevated osteogenic properties. PMID: 25564652
CD73 and TNAP play interactive roles to metabolize luminally applied 5'-AMP in the renal vasculature such that inhibition of both is required to inhibit the production of adenosine. PMID: 24990899
CD73-dependent adenosine signaling is prominent in the mature GC and required for establishment of the long-lived PC compartment, thus identifying a novel role for CD73 in humoral immunity PMID: 24664100
that extracellular adenosine, generated in tandem by ecto-enzymes CD39 and CD73, promotes dermal fibrogenesis. PMID: 24266925
CD73-dependent production of extracellular adenosine and endothelial Adora2b signaling protects kidney during diabetic nephropathy. PMID: 24262796
Isoflurane causes TGF-beta1-dependent induction of renal tubular CD73 and adenosine generation to protect against renal ischemia and reperfusion injury. PMID: 23423261
identify CD73 as a TCR ligand-induced cell surface protein that distinguishes gammadeltaTCR-expressing CD4(-)CD8(-) progenitors that have committed to the gammadelta fate from those that have not yet done so PMID: 24493796
CD73 mRNA levels were also dramatically decreased in human liver biopsies from hepatitis C and nonalcoholic fatty liver disease patients PMID: 23729294
Data indicate that CD73 promoted metastasis through the activation of both A2A and A2B receptors. PMID: 23964122
Our data provide evidence for a role of CD73 in the regulation of learning and memory and psychomotor coordination PMID: 23274765
findings demonstrate that CD73-expressing exosomes produced by Treg cells following activation contribute to their suppressive activity through the production of adenosine PMID: 23749427
Our novel findings suggest an important immune-regulatory role of CD73 in regulation of diabetes development PMID: 23956420
NT5E (and prostatic acid phosphatase) are the main AMP ectonucleotidases in somatosensory neurons. PMID: 23825434
CD73 is upregulated in immune cells after ischemia/reperfusion in the myocardium. PMID: 23720442

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.