Recombinant Mouse Complement C1Q Subcomponent Subunit A (C1QA) Protein (His)

Name: Recombinant Mouse Complement C1Q Subcomponent Subunit A (C1QA) Protein (His)
Brand: Beta LifeScience
SKU: BLC-02104P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse Complement C1Q Subcomponent Subunit A (C1QA) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P98086
Target Symbol	C1QA
Synonyms	C1qaComplement C1q subcomponent subunit A
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
Expression Range	23-245aa
Protein Length	Full Length of Mature Protein
Mol. Weight	29.1 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Subcellular Location	Secreted.
Database References	KEGG: mmu:12259 STRING: 10090.ENSMUSP00000048836 UniGene: Mm.439957

Gene Functions References

C1qa(-/-) mice did not show any differences in photoreceptor loss or inflammation at 7 days compared to wild-type PMID: 30126455
The results presented here demonstrate that the C1q expression in aged females experience a distinct difference in brain aging when compared to age-matched males, suggesting females undergo a higher level of microglial activation with age. PMID: 28732515
this study shows that regulatory dendritic cells can mediate a potent direct anti-inflammatory activity via the expression and/or secretion of molecules such as C1q, independently of their capacity to expand the pool of regulatory T cells PMID: 27731323
Data preliminarily suggest that complement C1q activity may aid in the clearance of the Toxoplasma gondii parasite from the central nervous system and in so doing, have consequences for the connectivity of neighboring cells and synapses PMID: 27109609
analysis of molecular signaling and inflammatory responses during ingestion of atherogenic lipoproteins modulated by complement protein C1q PMID: 27573737
C1q-/- mice manifest increased frequency of fetal resorption, reduced fetal weight, and smaller litter size when compared to their wild-type counterparts PMID: 27687635
This study demonstrated that microglia, but not neurons or peripheral sources, are the dominant source of C1q in the brain. PMID: 28264694
findings show that C1q rather than FcgammaRs controls the Ab-mediated Ag uptake and its presentation by spleen APC subsets to T cells PMID: 28432146
Demonstrate local synthesis of complement proteins by both PDGFRbeta-positive pericytes and CD45-positive cells in kidney fibrosis. PMID: 28052876
Deleting C1qa gene significantly reduces synaptic pruning by Grn(-/-) microglia and mitigates neurodegeneration, behavioral phenotypes, and premature mortality in Grn(-/-) mice; results uncover a previously unrecognized role of progranulin in suppressing aberrant microglia activation during aging. PMID: 27114033
C1q level may be a surrogate of prediction marker representing neurodegenerative disease progress before developing behavioral impairment. PMID: 26728245
developmental mechanisms of C1qa may be re-engaged during injury response PMID: 27008854
that inhibition of C1 is sufficient to preserve dendritic and synaptic architecture PMID: 27048300
These findings support a role for locally synthesized C1q in promoting tumor growth. PMID: 26831747
C1q is involved in the pristane-mediated enhanced inflammatory response to TLR7 stimulation. PMID: 26773156
C1q has a role in pulmonary vascular homeostasis and preventing injury to lung endothelium PMID: 26487714
Data (including data from studies in mutant mice) suggest exercise prevents age-related neurovascular decline, up-regulation of C1qa, and down-regulation of astrocytic Apoe; this preventive effect of exercise does not occur in Apoe-deficient mice. PMID: 26512759
critical role in activation of beta-catenin signalling in hypertensive arterial remodelling PMID: 25716000
G allele in rs172378 risk factor for lupus nephritis in a homozygous status PMID: 25326229
Data (including data on knockout mice) suggest, in absence of Trem2 (triggering receptor expressed on myeloid cells 2), pulmonary macrophages selectively produce elevated levels of C1q resulting in enhanced phagocytosis during pneumococcal pneumonia. PMID: 24945405
Complement protein C1q promotes macrophage anti-inflammatory M2-like polarization during the clearance of atherogenic lipoproteins PMID: 25091012
C1q was significantly reduced in newly diagnosed schizophrenic patients or schizophrenic patients on medication compared with the controls. PMID: 23235303
C1q induction and global complement pathway activation do not contribute to ALS toxicity in mutant SOD1 mice. PMID: 24170856
The structural abnormalities, together with increased numbers of excitatory synapses, likely contribute to epileptogenesis in C1q KO mice. PMID: 23621154
C1q-induced LRP1B and GPR6 proteins expressed early in Alzheimer disease mouse models, are essential for the C1q-mediated protection against amyloid-beta neurotoxicity PMID: 23150673
These findings suggest that C1q recognizes an alternative binding partner expressed by stressed retinal ganglion cells. PMID: 22918632
Findings suggest the unexpected role of complement C1q in Wnt signal transduction and modulation of mammalian aging. PMID: 22682250
Our data indicate that C1q could have a role in regulating platelet activation and associated leukocyte recruitment during vessel wall injury. PMID: 22142906
Levels of C1q rise substantially in retinal tissues over the course of degeneration. in the absence of C1q, cone photoreceptor function and viability are significantly compromised. PMID: 21863053
analysis of the molecular mechanisms for synchronized transcription of three complement C1q subunit genes (A, B and C) in dendritic cells and macrophages PMID: 21862594
Leukocyte recruitment and C1q-hemolytic activity was restored to wild type levels when CD93 was expressed on either hematopoietic cells or nonhematopoietic cells in bone marrow chimeric mice PMID: 21849679
C1q, a marker of microglial activation, is upregulated in the nigrostriatal system following subchronic 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP); nigrostriatal dopaminergic injury is not affected by C1q in this model of Parkinson disease. PMID: 21640391
Mice with a mutation in complement component 1a (C1qa) were protected from glaucoma. PMID: 21383504
Complement 1q (C1q)-deficient mice lacking the classical complement pathway show significantly reduced survival and increased organ dysfunction, following cecal ligation and puncture when compared with control mice. PMID: 21263075
C1q directly promotes neuronal survival, thereby demonstrating new interactions between immune proteins and neuronal cells that may facilitate neuroprotection. PMID: 21368058
Ethanol activates the classical complement pathway via C1q binding to apoptotic cells in the liver and that C1q contributes to the pathogenesis of ethanol-induced liver injury. PMID: 20416309
Complement protein C1q forms a complex with cytotoxic prion protein oligomers PMID: 20410306
These results suggest that C1q and C3 facilitate the induction of intranasal tolerance. PMID: 20213737
Bacterial titers of both Streptococcus pneumoniae serotype 6A and 14 in the middle ear lavage fluid samples from Bf/C2(-/)(-), Bf(-)(/)(-), and C1qa(-/)(-) mice were significantly higher than in samples from wild-type mice. PMID: 20065024
C1q contributes to apoptotic cell clearance in vitro, but its genetic deletion has no effect on pulmonary apoptotic cell clearance in vivo. PMID: 12244199
Elevated expression of splenic prion protein (PrP) may be dependent on C1q, since PrP up-regulation does not occur in spleens of C1q-deficient mice following treatment with preformed immune complexes or vesicular stomatitis virus. PMID: 12794132
Evaluation using C1q-deficient mice shows that lung injury following gastrointestinal ischemia-reperfusion injury is independent of C1q and classical complement activation. PMID: 15879138
alpha2beta1 integrin is a novel receptor for multiple collectins and the C1q complement protein PMID: 16166590
The transmembrane lectin SIGN-R1 therefore contributes to innate resistance by an unusual C3 activation pathway. PMID: 16615889
bacterial titers in the CNS were almost 12- and 20-fold higher in C1q- and C3-deficient-mice, respectively. Mean CSF leukocyte counts were reduced by 47 and 73% in C1q- and C3-deficient-mice, respectively PMID: 17237437
The in vitro binding and activation of the human and mouse complement systems was analysed and the susceptibility to infection in complement-deficient mouse strains, was tested. PMID: 18501966
C1q participates in scrapie prion protein PrP(Sc) uptake by conventional dendritic cells (cDCs), revealing a critical role for cDCs in initial prion capture, an event that takes place before the PrP(Sc) accumulation within the follicular DC network. PMID: 19155476
IgM antibodies play a central role in protection against atherosclerosis; the mechanism appears to be at least partly independent of classical pathway complement activation by C1q PMID: 19620499
ARRB2 acts to limit JNK/ERK activation and survival in macrophages. PMID: 19783052

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.