Recombinant Mouse Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 3 (LILRB3) Protein (His)

Name: Recombinant Mouse Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 3 (LILRB3) Protein (His)
Brand: Beta LifeScience
SKU: BLC-00781P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins, Others immune checkpoint proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 3 (LILRB3) Protein (His) is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P97484
Target Symbol	LILRB3
Species	Mus musculus (Mouse)
Expression System	Mammalian cell
Tag	C-6His
Target Protein Sequence	SLPKPILRVQPDSVVSRRTKVTFLCEETIGANEYRLYKDGKLYKTVTKNKQKPENKAEFSFSNVDLSNAGQYRCSYSTQYKSSGYSDLLELVVTGHYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVITSKRAMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGKFFIPSVTLQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFPYDKFILTKEDKKFGNSLDTEHISSSGQYRALFIIGPTTPTHTGAFRCYGYYKNAPQLWSVPSALQQILISGLSKKPSLLTHQGHILDPGMTLTLQCFSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQDSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMYLK
Expression Range	25-642aa
Protein Length	Partial
Mol. Weight	70.8 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM).
Subcellular Location	Cell membrane; Single-pass type I membrane protein.
Database References	KEGG: mmu:18733 STRING: 10090.ENSMUSP00000077546 UniGene: Mm.326531
Tissue Specificity	Detected in macrophages, splenocytes and B lymphocytes (at protein level). Detected in macrophages, mast cells, splenocytes, peritoneal cells and natural killer cells.

Gene Functions References

Loss of gp91 is associated with Bone resorption. PMID: 27897222
Results imply a neuron-specific, cell-autonomous action of PirB on synaptic density in L2/3 pyramidal cells of visual cortex; suggest that PirB is needed to match spine density and excitatory synaptic function to activity levels within cortical circuits, thereby providing headroom for the cell to encode additional experiences at new synapses. PMID: 27752542
peripheral CD4+ T cells from spontaneous murine arthritis model frequently express PIR-B PMID: 28664612
These results provide evidence for a critical role of the major histocompatibility complex class I/PirB signaling system in the generation of asymmetries in hippocampal circuitry. PMID: 28594961
These data identify paired Ig-like receptor B as a molecular checkpoint in IL-13-induced eosinophil accumulation and activation PMID: 27324131
the overexpression of PirB inhibits the neuronal survival through increased neuron apoptosis PMID: 27443384
neural plasticity in adult visual cortex is actively repressed and can be enhanced by blocking PirB function. PMID: 25320232
The Nogo-B-PirB axis controls macrophage-mediated vascular remodeling. PMID: 24278366
PIRB and LILRB2 were expressed in mouse and human platelets, respectively. PMID: 25075127
NogoA receptors, NogoR1 and PirB, are expressed in the ventricular zone where neural stem cells reside. PMID: 24449409
PirB expression is up-regulated after transient focal cerebral ischaemia. It may play pathologic roles in the inhibition of axonal regeneration after stroke. PMID: 23927735
PirB normally regulates spine and excitatory synapse density and consequently the threshold for new learning throughout life. PMID: 24302763
In mice, the deleterious effect of Abeta oligomers on hippocampal long-term potentiation required PirB, and in a transgenic model of Alzheimer's disease, PirB not only contributed to memory deficits present in adult mice, but also mediated loss of synaptic plasticity in juvenile visual cortex. PMID: 24052308
a key role for PIR-B in IPF, likely via the regulation of macrophage activation PMID: 23258232
study indicates an unexpected functional significance of classical immune-inhibitory receptors in maintenance of stemness of normal adult stem cells and in support of cancer development PMID: 22660330
findings, coupled with previous studies, may imply that PirB is probably a critical molecule in inhibition of axonal regeneration by myelin inhibitors after ON injury PMID: 22102155
This study demonistrated that significant neuroprotection in the absence of the innate immune receptor PirB in mice model of stroke. PMID: 22445338
the p75 receptor is required for the signal transduction of PIR- PMID: 21881600
the major promoter of Pirb, and probably Pira as well, is activated dominantly by PU.1 and marginally by Runx3 in B cells. PMID: 21555536
a novel mechanism by which PIR-B-mediated regulation is achieved differentially but competitively via MHCI and Nogo in cells of the immune system PMID: 21636572
Thus, PIR-B associated with Trk to downregulate basal and neurotrophin-regulated Trk activity through SHP-1/2 in neurons. PMID: 21364532
myeloid-derived suppressor cells genetically ablated for PIR-B underwent a specific transition to M1-like cells when entering the periphery from bone marrow, resulting in decreased suppressive function, regulatory T cell activation activity. PMID: 21376641
PIR-B is an important regulator of innate immunity mediated by TLR9 in B-1 cells, which can otherwise provoke autoimmunity when overactivated (Review) PMID: 20976309
PIR-B knock-out is not sufficient to induce extensive axonal regeneration after spinal cord injury. PMID: 21087927
PirB and Nogo receptor-1 participate in ligand-dependent inhibition of synaptic plasticity in hippocampal slice cultures of adult mice. PMID: 20844138
Blocking the function of PirB is not sufficient to promote axonal reorganization or functional recovery after motor cortex injury. PMID: 20881122
PIR-B negatively regulates macrophage functions in response to pathogenic bacteria and chronic intestinal inflammatory responses. PMID: 20398663
PIR-B is critical for B cell suppression, DC maturation and for balancing T(H)1 and T(H)2 immune responses. PMID: 12021780
HLA-G inhibits the functions of murine dendritic cells via the PIR-B immune inhibitory receptor. PMID: 12207326
Mast cell regulation via paired immunoglobulin-like receptor PIR-B. Review. PMID: 12403357
PIR-B plays a role in regulating signal strength in adhesion-mediated activation of myeloid cells. PMID: 15494528
Hck and Fgr function as negative regulators of myeloid cell chemokine signaling by maintaining the tonic phosphorylation of PIR- PMID: 15723811
PirB, a major histocompatibility complex class I (MHCI) receptor, is expressed in central nervous system neurons and functions to limit the extent of experience-dependent plasticity in the visual cortex throughout life PMID: 16917027
We identify murine-paired Ig-like receptor (PIR)-B, and its human orthologs Ig-like transcript 2 and Ig-like transcript 5 as novel receptors for Staphylococcus aureus. PMID: 17371981
constitutive cis binding between LILRB2 or PIR-B and major histocompatibility complex class I has an essential role in regulating allergic responses PMID: 17420263
These findings indicate that sialylated O-linked sugar structures on CD99 play an important role in the recognition of PILR. PMID: 18209065
a single receptor can have dual functionality in distinct cell types after unique cellular signals PMID: 18316626
paired Ig-like receptor (PIR)-B, an MHC-I receptor expressed on antigen-presenting cells, can regulate CTL triggering by blocking the access of CD8 molecules to MHC-I PMID: 18787130
Deletion of PIR-B does not significantly alter either osteoclast or osteoblast function in vivo, at least up to 6 mo of age. PIR-B-deficient mice are not osteoporotic. PMID: 18802077
study found PirB, which has been implicated in nervous system plasticity, is a high-affinity receptor for Nogo, MAG, and OMgp; results implicate PirB in mediating axonal regeneration block PMID: 18988857
T cell expression of PIR-B with the cis-interacting MHC class I is strictly prohibited in periphery so as to secure prompt immune responses. PMID: 19684158
PIR-B on relatively primitive B cells, B-1 cells, suppresses TLR9 signaling via Bruton's tyrosine kinase (Btk) dephosphorylation, blocking the production of natural IgM antibodies. PMID: 19687229

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.